BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0939 (445 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50300-7|AAC48106.1| 645|Caenorhabditis elegans Hypothetical pr... 27 4.6 U41544-1|AAA83183.2| 2275|Caenorhabditis elegans Hypothetical pr... 27 4.6 >U50300-7|AAC48106.1| 645|Caenorhabditis elegans Hypothetical protein R03H4.5 protein. Length = 645 Score = 27.5 bits (58), Expect = 4.6 Identities = 7/23 (30%), Positives = 17/23 (73%) Frame = +1 Query: 163 HMYCIISVFVFLLVMEHIVSPRY 231 +++CI+S+F+ +V+ H+ +Y Sbjct: 315 YLFCILSIFIASIVLHHLFEKQY 337 >U41544-1|AAA83183.2| 2275|Caenorhabditis elegans Hypothetical protein M03A8.2 protein. Length = 2275 Score = 27.5 bits (58), Expect = 4.6 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = +1 Query: 328 KLHVSLKKYLSILYGRRISD-----PLNQVMKSGMIYDSNLQML 444 KLH+ K +L ILY R ++D P ++ +SN+Q L Sbjct: 900 KLHIPEKNFLEILYNRLVNDLALFQPAAPAFRNNQSTNSNVQPL 943 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,371,868 Number of Sequences: 27780 Number of extensions: 154797 Number of successful extensions: 336 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 767282256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -