BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= P5PG0938
(613 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U41011-8|AAA82291.2| 321|Caenorhabditis elegans Collagen protei... 28 4.6
U40938-6|AAA81698.1| 655|Caenorhabditis elegans Hypothetical pr... 28 6.0
>U41011-8|AAA82291.2| 321|Caenorhabditis elegans Collagen protein
114 protein.
Length = 321
Score = 28.3 bits (60), Expect = 4.6
Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
Frame = +2
Query: 146 SYKFIHNNS-CFTFVFVITLCFDYPSVLILEMYILHV 253
+Y+++ N + CF V V+T+C P++ MY+ HV
Sbjct: 11 AYQWVANIAMCFAIVSVLTVCVSMPAIY---MYMFHV 44
>U40938-6|AAA81698.1| 655|Caenorhabditis elegans Hypothetical
protein D1009.1a protein.
Length = 655
Score = 27.9 bits (59), Expect = 6.0
Identities = 10/13 (76%), Positives = 11/13 (84%)
Frame = -1
Query: 523 GLCLPTCPGETGE 485
GLC+P PGETGE
Sbjct: 441 GLCVPCVPGETGE 453
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,323,651
Number of Sequences: 27780
Number of extensions: 206112
Number of successful extensions: 468
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 468
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1321669750
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -