SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0938
         (613 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41011-8|AAA82291.2|  321|Caenorhabditis elegans Collagen protei...    28   4.6  
U40938-6|AAA81698.1|  655|Caenorhabditis elegans Hypothetical pr...    28   6.0  

>U41011-8|AAA82291.2|  321|Caenorhabditis elegans Collagen protein
           114 protein.
          Length = 321

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +2

Query: 146 SYKFIHNNS-CFTFVFVITLCFDYPSVLILEMYILHV 253
           +Y+++ N + CF  V V+T+C   P++    MY+ HV
Sbjct: 11  AYQWVANIAMCFAIVSVLTVCVSMPAIY---MYMFHV 44


>U40938-6|AAA81698.1|  655|Caenorhabditis elegans Hypothetical
           protein D1009.1a protein.
          Length = 655

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -1

Query: 523 GLCLPTCPGETGE 485
           GLC+P  PGETGE
Sbjct: 441 GLCVPCVPGETGE 453


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,323,651
Number of Sequences: 27780
Number of extensions: 206112
Number of successful extensions: 468
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 468
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1321669750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -