BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0932 (580 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 28 4.8 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) 28 6.3 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 6.3 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 28 6.3 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 28 6.3 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 28 6.3 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 6.3 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 8.4 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 8.4 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 8.4 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 27 8.4 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 27 8.4 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 8.4 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 27 8.4 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 72 IKYNVPISL*FPRADSCSPGDPLV 1 I N+P L P ++SCSPGDPLV Sbjct: 9 ISANIPHELLAPTSNSCSPGDPLV 32 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 31.1 bits (67), Expect = 0.68 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 120 IKSLKDVPIIPDQIPKIKYNVPISL*FPRADSCSPGDPLV 1 I LK V + D + N+ ++ ++SCSPGDPLV Sbjct: 517 IAKLKGVSLSSDAFFPFRDNIDRAVQIQESNSCSPGDPLV 556 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 PR++SCSPGDPLV Sbjct: 2 PRSNSCSPGDPLV 14 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 PR++SCSPGDPLV Sbjct: 21 PRSNSCSPGDPLV 33 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 PR++SCSPGDPLV Sbjct: 68 PRSNSCSPGDPLV 80 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 PR++SCSPGDPLV Sbjct: 16 PRSNSCSPGDPLV 28 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 FP ++SCSPGDPLV Sbjct: 23 FPGSNSCSPGDPLV 36 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -2 Query: 135 PNSARIKSLKDVPIIPDQIPKIKYNVPISL*FPRADSCSPGDPLV 1 P+ A D +I D+ P K P+ ++SCSPGDPLV Sbjct: 20 PSDATPTEFPDTTVITDKPPPKKG--PVQDEIKISNSCSPGDPLV 62 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 60 VPISL*FPRADSCSPGDPLV 1 + +SL F ++SCSPGDPLV Sbjct: 5 ITLSLGFVPSNSCSPGDPLV 24 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 F R++SCSPGDPLV Sbjct: 6 FARSNSCSPGDPLV 19 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 F R++SCSPGDPLV Sbjct: 19 FERSNSCSPGDPLV 32 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 60 VPISL*FPRADSCSPGDPLV 1 V +S+ F ++SCSPGDPLV Sbjct: 34 VKVSISFFLSNSCSPGDPLV 53 >SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 72 IKYNVPISL*FPRADSCSPGDPLV 1 I N+ I + ++SCSPGDPLV Sbjct: 9 ISANITIDIDHKGSNSCSPGDPLV 32 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 55 NIFMISSCRFLQPGGSTS 2 N +ISS FLQPGGSTS Sbjct: 15 NYNIISSIEFLQPGGSTS 32 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P+++SCSPGDPLV Sbjct: 30 PQSNSCSPGDPLV 42 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 +P ++SCSPGDPLV Sbjct: 70 YPPSNSCSPGDPLV 83 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 +P ++SCSPGDPLV Sbjct: 28 YPVSNSCSPGDPLV 41 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 3 LVDPPGCRNRHEEIIKILE 59 LVDPPGCRN ++ K L+ Sbjct: 15 LVDPPGCRNSISKLCKDLD 33 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 F R++SCSPGDPLV Sbjct: 14 FFRSNSCSPGDPLV 27 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 + R++SCSPGDPLV Sbjct: 6 YERSNSCSPGDPLV 19 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 105 DVPIIPDQIPKIKYNVPISL*FPRADSCSPGDPLV 1 D+ I + + N+ I L R++SCSPGDPLV Sbjct: 32 DLAITQISLSPLYPNLTIDL-HVRSNSCSPGDPLV 65 >SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 58 SNIFMISSCRFLQPGGSTS 2 +NI +++ FLQPGGSTS Sbjct: 11 ANIVLVNFIEFLQPGGSTS 29 >SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 52 IFMISSCRFLQPGGSTS 2 +F++ + FLQPGGSTS Sbjct: 22 VFLLKNIEFLQPGGSTS 38 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 61 CSNIFMISSCRFLQPGGSTS 2 C ++ + S FLQPGGSTS Sbjct: 28 CLSLMHVFSIEFLQPGGSTS 47 >SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) Length = 414 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 330 GGRSQNLILFIRGNAISGAPSI 265 GG S+NLI F G I G PS+ Sbjct: 99 GGESKNLINFALGQDIGGVPSV 120 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 9 PASNSCSPGDPLV 21 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.9 bits (59), Expect = 6.3 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 99 PIIPDQIPKIKYNVPISL*FPRADSCSPGDPLV 1 P+ P+QI K N R++SCSPGDPLV Sbjct: 25 PMAPNQIWKNHKNY-------RSNSCSPGDPLV 50 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 140 PSSNSCSPGDPLV 152 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 15 PTSNSCSPGDPLV 27 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -2 Query: 72 IKYNVPISL*FPRADSCSPGDPLV 1 + + + + + F ++SCSPGDPLV Sbjct: 22 VSWQILLQVGFKVSNSCSPGDPLV 45 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 58 SNIFMISSCRFLQPGGSTS 2 + I ISS FLQPGGSTS Sbjct: 55 AEIAEISSIEFLQPGGSTS 73 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 79 TKNKI*CSNIFMISSCRFLQPGGSTS 2 T+NK+ C + + FLQPGGSTS Sbjct: 58 TENKVTCHKC-NLKTIEFLQPGGSTS 82 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 Query: 3 LVDPPGCRNRHEEI 44 LVDPPGCRN ++I Sbjct: 15 LVDPPGCRNSMDDI 28 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 46 PTSNSCSPGDPLV 58 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 69 KYNVPISL*FPRADSCSPGDPLV 1 KY + L P ++SCSPGDPLV Sbjct: 130 KYRLMFHL--PGSNSCSPGDPLV 150 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 81 IPKIKYNVPISL*FPRADSCSPGDPLV 1 I K N I F ++SCSPGDPLV Sbjct: 15 IEKANDNARIVTKFGVSNSCSPGDPLV 41 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 69 KYNVPISL*FPR-ADSCSPGDPLV 1 KY P S PR ++SCSPGDPLV Sbjct: 6 KYFEPDSNQRPRESNSCSPGDPLV 29 >SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 42 FPRADSCSPGDPLV 1 F A SCSPGDPLV Sbjct: 3 FTHAHSCSPGDPLV 16 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -2 Query: 51 SL*FPR-ADSCSPGDPLV 1 SL FP ++SCSPGDPLV Sbjct: 58 SLYFPETSNSCSPGDPLV 75 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 5 PTSNSCSPGDPLV 17 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 18 PASNSCSPGDPLV 30 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 182 PPSNSCSPGDPLV 194 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 16 PPSNSCSPGDPLV 28 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 381 RSNSCSPGDPLV 392 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 13 RSNSCSPGDPLV 24 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 63 PLSNSCSPGDPLV 75 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 875 RSNSCSPGDPLV 886 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 3 LVDPPGCRNRHEEIIKIL 56 LVDPPGCRN + ++L Sbjct: 15 LVDPPGCRNSIRTVAQLL 32 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 66 RSNSCSPGDPLV 77 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 16 PLSNSCSPGDPLV 28 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 63 RSNSCSPGDPLV 74 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 19 PPSNSCSPGDPLV 31 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 49 FMISSCRFLQPGGSTS 2 F+I FLQPGGSTS Sbjct: 26 FLIGDIEFLQPGGSTS 41 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 102 VPIIPDQIPKIKYNVPISL*FPRADSCSPGDPLV 1 V +P + + ++ +S +++SCSPGDPLV Sbjct: 50 VESVPHSLQMLAFSC-VSCVVQKSNSCSPGDPLV 82 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 558 RSNSCSPGDPLV 569 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 110 RSNSCSPGDPLV 121 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 6 RSNSCSPGDPLV 17 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 39 PPSNSCSPGDPLV 51 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 92 RSNSCSPGDPLV 103 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 20 RSNSCSPGDPLV 31 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 102 VPIIPDQIPKIKYNVPISL*FPRADSCSPGDPLV 1 +P++ IP + +P+ ++SCSPGDPLV Sbjct: 38 IPLLYPYIPLLYTYIPLL-----SNSCSPGDPLV 66 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 64 RSNSCSPGDPLV 75 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 44 RSNSCSPGDPLV 55 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 11 RSNSCSPGDPLV 22 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 17 RSNSCSPGDPLV 28 >SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) Length = 156 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 52 IFMISSCRFLQPGGSTS 2 +F +S FLQPGGSTS Sbjct: 28 LFTLSPIEFLQPGGSTS 44 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 45 RSNSCSPGDPLV 56 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 59 RSNSCSPGDPLV 70 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 322 RSNSCSPGDPLV 333 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 60 RSNSCSPGDPLV 71 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 55 RSNSCSPGDPLV 66 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 96 PPSNSCSPGDPLV 108 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 24 PGSNSCSPGDPLV 36 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 214 RSNSCSPGDPLV 225 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 11 PGSNSCSPGDPLV 23 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 27.5 bits (58), Expect = 8.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +3 Query: 3 LVDPPGCRNRHEEII 47 LVDPPGCRN ++++ Sbjct: 102 LVDPPGCRNSIQQMV 116 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 19 RSNSCSPGDPLV 30 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 1 RSNSCSPGDPLV 12 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 35 RSNSCSPGDPLV 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,166,558 Number of Sequences: 59808 Number of extensions: 208858 Number of successful extensions: 2018 Number of sequences better than 10.0: 121 Number of HSP's better than 10.0 without gapping: 1993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2018 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -