BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0931 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_7569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) 30 1.9 SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 29 2.5 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 29 4.4 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 29 4.4 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 29 4.4 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 29 4.4 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 28 5.8 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 5.8 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 28 5.8 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 28 5.8 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 7.7 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 28 7.7 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 28 7.7 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 129 VRHFMSAMVLINTKAMSPRHLTQIQCDPRAEFLQPGGST 13 ++HF ++ N K + +IQ +P EFLQPGGST Sbjct: 1 MKHFTDTLISANIKIIFQEADQEIQYNPEIEFLQPGGST 39 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 62 RFSVTLVPNSCSPGDPL 12 R+ V+L+ NSCSPGDPL Sbjct: 28 RYRVSLISNSCSPGDPL 44 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 59 FSVTLVPNSCSPGDPL 12 F +T V NSCSPGDPL Sbjct: 5 FRITAVSNSCSPGDPL 20 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 62 RFSVTLVPNSCSPGDPL 12 RF + L+ NSCSPGDPL Sbjct: 16 RFPLFLISNSCSPGDPL 32 >SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 129 VRHFMSAMVLINTKAMSPRHLTQIQCDPRAEFLQPGGST 13 ++HF ++ N K+ S + + EFLQPGGST Sbjct: 1 MKHFTDTLISANIKSTSGGPIKTLYKQSLIEFLQPGGST 39 >SB_7569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 129 VRHFMSAMVLIN-TKAMSPRHLTQIQCDPRAEFLQPGGST 13 ++HF ++ N + ++P LT++ D EFLQPGGST Sbjct: 1 MKHFTDTLISANIAEEVAPGRLTRMALDI-IEFLQPGGST 39 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 30 SISLISNSCSPGDPL 44 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 31.1 bits (67), Expect = 0.83 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 66 TQIQCDPRAEFLQPGGST 13 T DPR EFLQPGGST Sbjct: 34 TSFGSDPRIEFLQPGGST 51 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 30 SISLISNSCSPGDPL 44 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 30 SISLISNSCSPGDPL 44 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 30 SISLISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 30 SISLISNSCSPGDPL 44 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 30 SISLISNSCSPGDPL 44 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 31 SISLISNSCSPGDPL 45 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 30 SISLISNSCSPGDPL 44 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S++L+ NSCSPGDPL Sbjct: 28 SISLISNSCSPGDPL 42 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 Query: 105 VLINTKAMSPRHLTQIQCDPRAEFLQPGGST 13 + I T + PRH T + EFLQPGGST Sbjct: 58 LFIQTLSYRPRH-TDLVIQTLIEFLQPGGST 87 >SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) Length = 1161 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 452 EIYEGFLAGQN*TCYKCLRWY 514 +I +G L GQ C++CLRW+ Sbjct: 117 DINDGSLCGQTQCCHRCLRWW 137 >SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1175 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 452 EIYEGFLAGQN*TCYKCLRWY 514 +I +G L GQ C++CLRW+ Sbjct: 838 DINDGSLCGQTQCCHRCLRWW 858 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 80 HPDT*LRFSVTLVP-NSCSPGDPL 12 HPD L + + P NSCSPGDPL Sbjct: 4 HPDACLVMVLHVPPSNSCSPGDPL 27 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 2 AL*TVDPPGCRNSARGS 52 AL VDPPGCRNS GS Sbjct: 12 ALELVDPPGCRNSMIGS 28 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S TL+ NSCSPGDPL Sbjct: 59 SRTLLSNSCSPGDPL 73 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 50 TLVPNSCSPGDPL 12 T+V NSCSPGDPL Sbjct: 76 TIVSNSCSPGDPL 88 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 62 RFSVTLVPNSCSPGDPL 12 + S+T NSCSPGDPL Sbjct: 32 QLSITSTSNSCSPGDPL 48 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S+ V NSCSPGDPL Sbjct: 15 SIAFVSNSCSPGDPL 29 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 59 FSVTLVPNSCSPGDPL 12 F LV NSCSPGDPL Sbjct: 1 FMCMLVSNSCSPGDPL 16 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 VT+ NSCSPGDPL Sbjct: 2 VTIASNSCSPGDPL 15 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 +T+V NSCSPGDPL Sbjct: 17 LTVVSNSCSPGDPL 30 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 62 RFSVTLVPNSCSPGDPL 12 R +T NSCSPGDPL Sbjct: 15 RLDLTFTSNSCSPGDPL 31 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = -3 Query: 59 FSVTL-VPNSCSPGDPL 12 F VTL V NSCSPGDPL Sbjct: 8 FRVTLEVSNSCSPGDPL 24 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/19 (68%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 65 LRFSVTLVP-NSCSPGDPL 12 L FS+ L+ NSCSPGDPL Sbjct: 138 LLFSINLITSNSCSPGDPL 156 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 VT + NSCSPGDPL Sbjct: 512 VTFLSNSCSPGDPL 525 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 74 DT*LRFSVTLVPNSCSPGDPL 12 DT + ++ + NSCSPGDPL Sbjct: 6 DTLISANIVHISNSCSPGDPL 26 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 50 TLVPNSCSPGDPL 12 TL+ NSCSPGDPL Sbjct: 1 TLLSNSCSPGDPL 13 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 2 AL*TVDPPGCRNSARG 49 AL VDPPGCRNS G Sbjct: 12 ALELVDPPGCRNSIEG 27 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 2 AL*TVDPPGCRNSARGS 52 AL VDPPGCRNS R + Sbjct: 12 ALELVDPPGCRNSIRST 28 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S +V NSCSPGDPL Sbjct: 10 SANIVSNSCSPGDPL 24 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 50 TLVPNSCSPGDPL 12 T++ NSCSPGDPL Sbjct: 3 TIISNSCSPGDPL 15 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 +TL NSCSPGDPL Sbjct: 1 MTLASNSCSPGDPL 14 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 2 AL*TVDPPGCRNSARGSH 55 AL VDPPGCRNS G + Sbjct: 88 ALELVDPPGCRNSIAGKN 105 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 3.3 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -3 Query: 62 RFSVTLVPNSCSPGDPL 12 ++++ + NSCSPGDPL Sbjct: 15 KYAIDIASNSCSPGDPL 31 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 92 QKRCHPDT*LRFSVTLVPNSCSPGDPL 12 +++CH R + NSCSPGDPL Sbjct: 17 KRQCHTSQNKRPENKALSNSCSPGDPL 43 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 74 DT*LRFSVTLVPNSCSPGDPL 12 DT + ++ NSCSPGDPL Sbjct: 6 DTLISANICFTSNSCSPGDPL 26 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -2 Query: 129 VRHFMSAMVLINTKAMSPRHLTQIQCDPRAEFLQPGGST 13 ++HF ++ N H ++ P EFLQPGGST Sbjct: 1 MKHFTDTLISANI------HCVDVKAYPCIEFLQPGGST 33 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 99 INTKAMSPRHLTQIQCDPRAEFLQPGGST 13 + T P L ++Q EFLQPGGST Sbjct: 209 LRTHHKDPESLHRLQNPSEIEFLQPGGST 237 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 2 AL*TVDPPGCRNSAR 46 AL VDPPGCRNS R Sbjct: 12 ALELVDPPGCRNSIR 26 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 59 FSVTLVPNSCSPGDPL 12 F + ++ NSCSPGDPL Sbjct: 29 FGIGVLSNSCSPGDPL 44 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 50 TLVPNSCSPGDPL 12 TL NSCSPGDPL Sbjct: 5 TLASNSCSPGDPL 17 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S ++ NSCSPGDPL Sbjct: 10 SANIISNSCSPGDPL 24 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 65 LRFSVTLVPNSCSPGDPL 12 + + +V NSCSPGDPL Sbjct: 1 MNMMIVVVSNSCSPGDPL 18 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 2 AL*TVDPPGCRNSARGS 52 AL VDPPGCRNS G+ Sbjct: 29 ALELVDPPGCRNSIDGN 45 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 59 FSVTLVPNSCSPGDPL 12 + + +V NSCSPGDPL Sbjct: 7 YLIPMVSNSCSPGDPL 22 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 65 LRFSVTLVPNSCSPGDPL 12 L +V ++ NSCSPGDPL Sbjct: 59 LALTVFMLSNSCSPGDPL 76 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 ++ ++ NSCSPGDPL Sbjct: 2 TIVIISNSCSPGDPL 16 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 71 T*LRFSVTLVPNSCSPGDPL 12 T L+F V+ V NSCSPGDPL Sbjct: 9 TWLKF-VSKVSNSCSPGDPL 27 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 V L+ NSCSPGDPL Sbjct: 14 VFLISNSCSPGDPL 27 >SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = -2 Query: 129 VRHFMSAMVLINTKAMSPRH-----LTQIQCDPRAEFLQPGGST 13 ++HF ++ N + + H T C EFLQPGGST Sbjct: 1 MKHFTDTLISANIELIEVCHQKLSDFTYYCCATHIEFLQPGGST 44 >SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 78 PRHLTQIQCDPRAEFLQPGGST 13 P HL+ P EFLQPGGST Sbjct: 16 PSHLSPPGYWPEIEFLQPGGST 37 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S ++ NSCSPGDPL Sbjct: 10 SANIISNSCSPGDPL 24 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 2 AL*TVDPPGCRNSARG 49 AL VDPPGCRNS G Sbjct: 99 ALELVDPPGCRNSITG 114 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 74 DT*LRFSVTLVPNSCSPGDPL 12 DT + +++ NSCSPGDPL Sbjct: 6 DTLISANISQTSNSCSPGDPL 26 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 24 LVSNSCSPGDPL 35 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 +V V NSCSPGDPL Sbjct: 6 AVLFVSNSCSPGDPL 20 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 3 LVSNSCSPGDPL 14 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 65 LRFSVTLVPNSCSPGDPL 12 LR S + NSCSPGDPL Sbjct: 15 LRNSSNISSNSCSPGDPL 32 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 395 EADYWEQMKAKYDPKDEFKEIY-EGFLAG 478 +AD W + A YD +D F +IY G L G Sbjct: 5963 DADEWYHVAATYDSRDRFAKIYINGELKG 5991 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 2 AL*TVDPPGCRNSARGSH 55 AL VDPPGCRNS S+ Sbjct: 656 ALELVDPPGCRNSISSSN 673 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 17 LVSNSCSPGDPL 28 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 + L+ NSCSPGDPL Sbjct: 6 IYLISNSCSPGDPL 19 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 9 LVSNSCSPGDPL 20 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 98 STQKRCHPDT*LRFSVTLVPNSCSPGDPL 12 ST RC D NSCSPGDPL Sbjct: 99 STVSRCVSDVTRALVSKAESNSCSPGDPL 127 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 62 RFSVTLVPNSCSPGDPL 12 R L+ NSCSPGDPL Sbjct: 19 RVRFPLISNSCSPGDPL 35 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S T++ NSCSPGDPL Sbjct: 16 SRTVLSNSCSPGDPL 30 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 2 LVSNSCSPGDPL 13 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 71 T*LRFSVTLVPNSCSPGDPL 12 T + F+ V NSCSPGDPL Sbjct: 9 TSMNFNHLKVSNSCSPGDPL 28 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S+ L NSCSPGDPL Sbjct: 658 SLQLASNSCSPGDPL 672 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 +T NSCSPGDPL Sbjct: 6 ITTTSNSCSPGDPL 19 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 50 TLVPNSCSPGDPL 12 ++V NSCSPGDPL Sbjct: 346 SIVSNSCSPGDPL 358 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 17 LISNSCSPGDPL 28 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S + V NSCSPGDPL Sbjct: 11 SASQVSNSCSPGDPL 25 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -3 Query: 74 DT*LRFSVTLVP-NSCSPGDPL 12 DT + ++T P NSCSPGDPL Sbjct: 6 DTLISANITWRPSNSCSPGDPL 27 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S ++ NSCSPGDPL Sbjct: 10 SANILSNSCSPGDPL 24 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 59 FSVTLVPNSCSPGDPL 12 F V L NSCSPGDPL Sbjct: 1016 FVVGLGSNSCSPGDPL 1031 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 37 LISNSCSPGDPL 48 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 65 LRFSVTLVPNSCSPGDPL 12 +R V V NSCSPGDPL Sbjct: 33 IREFVLRVSNSCSPGDPL 50 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 75 RHLTQIQCDPRA-EFLQPGGST 13 R L + + DPR EFLQPGGST Sbjct: 29 RDLYRTRRDPRTIEFLQPGGST 50 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S TL NSCSPGDPL Sbjct: 11 SRTLRSNSCSPGDPL 25 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 + L+ NSCSPGDPL Sbjct: 52 IPLLSNSCSPGDPL 65 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 50 TLVPNSCSPGDPL 12 T+ NSCSPGDPL Sbjct: 45 TITSNSCSPGDPL 57 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 40 LISNSCSPGDPL 51 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 65 LRFSVTLVPNSCSPGDPL 12 +R + L NSCSPGDPL Sbjct: 14 VREAAPLASNSCSPGDPL 31 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 V+L NSCSPGDPL Sbjct: 4 VSLSSNSCSPGDPL 17 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 70 LISNSCSPGDPL 81 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 65 LRFSVTLVPNSCSPGDPL 12 L + +V NSCSPGDPL Sbjct: 79 LTLTQRIVSNSCSPGDPL 96 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 59 FSVTLVPNSCSPGDPL 12 + + L NSCSPGDPL Sbjct: 7 YFIMLASNSCSPGDPL 22 >SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 129 VRHFMSAMVLINTKAMSPRHLTQIQCDPRAEFLQPGGST 13 ++HF ++ N + + +++ EFLQPGGST Sbjct: 1 MKHFTDTLISANINKIRYQATNKLRNHCLIEFLQPGGST 39 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 56 SVTLVPNSCSPGDPL 12 S ++ NSCSPGDPL Sbjct: 14 SAPVISNSCSPGDPL 28 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 65 LRFSVTLVPNSCSPGDPL 12 LR + NSCSPGDPL Sbjct: 56 LRHGSNFLSNSCSPGDPL 73 >SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 129 VRHFMSAMVLINTKAMSPRHLTQIQCDPRAEFLQPGGST 13 ++HF LI+ +S H +C EFLQPGGST Sbjct: 1 MKHFTDT--LISANIVSIEHTEHKRCSC-IEFLQPGGST 36 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 V V NSCSPGDPL Sbjct: 20 VNAVSNSCSPGDPL 33 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 53 VTLVPNSCSPGDPL 12 V++ NSCSPGDPL Sbjct: 17 VSITSNSCSPGDPL 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,191,763 Number of Sequences: 59808 Number of extensions: 407294 Number of successful extensions: 2611 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 2539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2608 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -