BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0931 (658 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40410.1 68418.m04901 pentatricopeptide (PPR) repeat-containi... 29 2.1 At3g24260.1 68416.m03047 hypothetical protein 29 2.1 At5g55180.1 68418.m06879 glycosyl hydrolase family 17 protein si... 28 6.3 At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) seve... 27 8.3 >At5g40410.1 68418.m04901 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1155 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 308 KDGMQTACAKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGF 469 + M TACA+C D V ARK+ + + + + W M + Y E +E F Sbjct: 177 RTAMVTACARCGD--VVFARKLFEGMPERDPIAWNAMISGYAQVGESREALNVF 228 >At3g24260.1 68416.m03047 hypothetical protein Length = 374 Score = 29.5 bits (63), Expect = 2.1 Identities = 23/101 (22%), Positives = 44/101 (43%), Gaps = 4/101 (3%) Frame = +2 Query: 182 DKYDNIDVDEILENRKLLVPYIKCVL----DEGRCTPDGKELKAHIKDGMQTACAKCTDK 349 D + + + IL N ++P I+ V D R D E K + + ++ + T Sbjct: 53 DHDEKPEENPILLNEPKMIPRIRIVYKPKDDVERKMKDRLEAKQKLTELLKAIEERLTRS 112 Query: 350 QKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGFL 472 + + K K H DY + +K+ D++K +Y+ F+ Sbjct: 113 ELRVYTCLCKDFKSHRIDYSQFVKSLQRLIDKYKNLYQRFV 153 >At5g55180.1 68418.m06879 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 460 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = +2 Query: 218 ENRKLLVPYIKCVLDEGRCTPDGKELKAHIKDGMQTACAK 337 +N++ +VP ++ + C +GK K +++G+ AC + Sbjct: 355 DNKEKVVPVKPSLVGQTWCVANGKTTKEKLQEGLDYACGE 394 >At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) several 40S ribosomal protein S26 Length = 130 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 287 KELKAHIKDGMQTACAKCTDKQKVSARKIVKHIKQHEA 400 K + H+K + C KC K K R IV++I + A Sbjct: 12 KHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAA 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,011,544 Number of Sequences: 28952 Number of extensions: 281710 Number of successful extensions: 702 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -