BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0929 (539 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.6 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.1 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 2.6 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +2 Query: 23 TAYRIPQSHTKLDTEAQSKLVRNIGAENRASEKSFGQI*EASADGRRPTSTFRNR 187 T I Q+H ++ + + ++ ENR E FG + R T RNR Sbjct: 1084 TLKHIIQTHGEMTDKQVEAYMLSLRDENRYHEDIFGITLRTAEVHNRSRETARNR 1138 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 110 LDFRHRYCGQALTELPYQVLYGIEGYD 30 +D R+ CG A+ + YG+ YD Sbjct: 313 VDIRNEDCGSAIAYVSDVFRYGLLIYD 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,241 Number of Sequences: 438 Number of extensions: 2658 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -