BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0925 (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) 28 6.7 SB_30671| Best HMM Match : rve (HMM E-Value=6.2e-32) 28 6.7 SB_35410| Best HMM Match : Mo-co_dimer (HMM E-Value=0) 27 8.8 SB_10593| Best HMM Match : SDF (HMM E-Value=0) 27 8.8 >SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) Length = 197 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 150 MSKSSCFFLISNANCSIEIRISKTKNY 70 M+KSS F I+ +NC +E+R+ K + Sbjct: 1 MAKSSRTFTIAISNCYVEVRLRKLNGF 27 >SB_30671| Best HMM Match : rve (HMM E-Value=6.2e-32) Length = 965 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 270 GVLHTHRLVSSKWFFPRWAQALIGTAKICYASEIS 374 G+ T L+ K++FPR + + IC++ ++S Sbjct: 605 GITKTKELLRRKYWFPRMNKRIEDIVSICFSCQVS 639 >SB_35410| Best HMM Match : Mo-co_dimer (HMM E-Value=0) Length = 141 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +3 Query: 471 HPSDSSKTLLKQEAVVTVQGVPLSSYMEDLLTNKISLNAGK 593 HP + +TLL++E VT+ G S ++ +SL+ GK Sbjct: 22 HPEEG-ETLLREEEEVTISGYAWSGGGRGIVRVDVSLDGGK 61 >SB_10593| Best HMM Match : SDF (HMM E-Value=0) Length = 629 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 459 RYTPHPSDSSKTLLKQEAVVTVQGVP 536 RYTPH +DS+ + A V GVP Sbjct: 343 RYTPHGTDSAHAVCSMGACGIVPGVP 368 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,233,625 Number of Sequences: 59808 Number of extensions: 402223 Number of successful extensions: 868 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -