BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0925 (602 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.0 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 3.0 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 3.0 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 3.0 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 7.0 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 7.0 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 7.0 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 7.0 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 9.3 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 9.3 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 9.3 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 303 KWFFPRWAQAL 335 K+FFP+W Q L Sbjct: 648 KFFFPKWLQVL 658 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 92 GSLRLKIIFTYHITDTTP 39 G L +FTY+IT++TP Sbjct: 202 GELFDATVFTYNITNSTP 219 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 92 GSLRLKIIFTYHITDTTP 39 G L +FTY+IT++TP Sbjct: 217 GELFDATVFTYNITNSTP 234 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 92 GSLRLKIIFTYHITDTTP 39 G L +FTY+IT++TP Sbjct: 105 GELFDATVFTYNITNSTP 122 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/32 (28%), Positives = 11/32 (34%) Frame = +3 Query: 162 FNHPWETVAQAAWRKYPNPMNPAVIGTDVVER 257 F+ W W +Y N GTD R Sbjct: 178 FSLGWTIAPMFGWNRYVPEGNMTACGTDYFNR 209 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 145 GHQNTHSTIH 174 GH+ HSTIH Sbjct: 192 GHRQRHSTIH 201 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/32 (28%), Positives = 11/32 (34%) Frame = +3 Query: 162 FNHPWETVAQAAWRKYPNPMNPAVIGTDVVER 257 F+ W W +Y N GTD R Sbjct: 54 FSLGWTIAPMFGWNRYVPEGNMTACGTDYFNR 85 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 7.0 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 579 EKFCWLKGLPCNY 541 E C +KG+PC++ Sbjct: 539 EHVCGVKGIPCSW 551 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 92 LISILQFALDIR 127 +I ILQF LD+R Sbjct: 51 IIEILQFILDVR 62 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 Query: 129 KNMKIWTSEHTFNHPWETVAQAAWRKYPNP 218 +++ I+ S H +H Q+ + Y NP Sbjct: 65 RDLPIYQSHHHLHHHQVLYQQSPYLMYENP 94 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 92 LISILQFALDIR 127 +I ILQF LD+R Sbjct: 19 IIEILQFILDVR 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,395 Number of Sequences: 438 Number of extensions: 4034 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -