BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0923 (581 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81544-2|CAB04434.1| 342|Caenorhabditis elegans Hypothetical pr... 29 2.4 AF016432-5|AAB65378.1| 347|Caenorhabditis elegans Seven tm rece... 29 2.4 >Z81544-2|CAB04434.1| 342|Caenorhabditis elegans Hypothetical protein F49C5.6 protein. Length = 342 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -3 Query: 222 RWHMFTKLITHSFS-ITFIVNEYIFFMLLTKVLKQ 121 +W K++ S + ++ ++N ++ FM+LTK KQ Sbjct: 5 QWSYLLKIVQDSSACVSLVINSFLIFMILTKSPKQ 39 >AF016432-5|AAB65378.1| 347|Caenorhabditis elegans Seven tm receptor protein 225 protein. Length = 347 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 219 WHMFTKLITHSFSI-TFIVNEYIFFMLLTKVLKQ 121 W +L+ HS ++ + I+N ++ +++LTK KQ Sbjct: 6 WSALLQLVQHSTAVFSIIINTFLIYLILTKSPKQ 39 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,097,554 Number of Sequences: 27780 Number of extensions: 179560 Number of successful extensions: 348 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1215936170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -