BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0920 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38172| Best HMM Match : Reticulon (HMM E-Value=4.4e-05) 69 3e-12 SB_13432| Best HMM Match : Reticulon (HMM E-Value=5.1e-16) 46 2e-05 SB_12537| Best HMM Match : DSPc (HMM E-Value=1.3e-09) 31 0.93 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_58463| Best HMM Match : DUF1168 (HMM E-Value=0.44) 29 3.7 SB_25665| Best HMM Match : TolA (HMM E-Value=1.7) 28 6.5 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 27 8.6 >SB_38172| Best HMM Match : Reticulon (HMM E-Value=4.4e-05) Length = 142 Score = 68.9 bits (161), Expect = 3e-12 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = +2 Query: 434 LRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYEM 589 +RRLFLVEDL DS+K V+L+ L+Y+ F+GITL +G+I LFT+PKAY+M Sbjct: 33 VRRLFLVEDLADSIKLLVVLYILSYLAQWFSGITLTFIGFIGLFTVPKAYDM 84 >SB_13432| Best HMM Match : Reticulon (HMM E-Value=5.1e-16) Length = 621 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/67 (35%), Positives = 35/67 (52%) Frame = +2 Query: 278 FRLYKNVLQAVQKTNDGHPFKWLLEAEVSVSXXXXXXXXXXXXXXXXXXXYELRRLFLVE 457 +R+ V+ A+QK+ +PFK LL+ E+ + LRRLFLVE Sbjct: 422 YRVGMTVMGAIQKSGTENPFKTLLDKEIEIPKEKAVEMAESLAEHINCLTKSLRRLFLVE 481 Query: 458 DLVDSLK 478 D+VDS+K Sbjct: 482 DIVDSIK 488 >SB_12537| Best HMM Match : DSPc (HMM E-Value=1.3e-09) Length = 195 Score = 30.7 bits (66), Expect = 0.93 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 517 RPHVREAPQQHAELQRVHQVLHQEQS 440 RPH+R A QQ + +Q+ H LH++ + Sbjct: 169 RPHIRLASQQWSAVQQFHDYLHEDDN 194 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 544 DDERDPVEARPHVREAPQQHAELQRVHQVLHQEQS 440 DD + E R R ++H ++ VH LH EQS Sbjct: 151 DDGWEGKEVRKEARRQEEEHRKVTVVHSKLHPEQS 185 >SB_58463| Best HMM Match : DUF1168 (HMM E-Value=0.44) Length = 603 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = -2 Query: 577 LRQREQRYPTEDDERDPVEARPHVREAPQQHAELQRVHQVLHQEQSAQ 434 ++Q++Q+Y + + + R ++ QQH + Q+ Q HQ+Q Q Sbjct: 272 IQQQQQQYIQQQQVQHMQQQRLQQQQLLQQHLQRQQQQQRRHQQQQQQ 319 >SB_25665| Best HMM Match : TolA (HMM E-Value=1.7) Length = 697 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -2 Query: 577 LRQREQRYPTEDDERDPVEARPHVREAPQQHAELQRVHQVLHQEQ 443 LR+R+QR+ + +R R ++ QQ +LQ++ Q +Q Sbjct: 267 LRERQQRHLQQQQQRQQQFQRQQQQQQMQQRQQLQQLQQQQQPQQ 311 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 514 PHVREAPQQHAELQRVHQVLHQEQSAQ 434 PHVR+ Q + R HQ LHQ + A+ Sbjct: 560 PHVRQGHQHPQRVPRRHQDLHQVRCAR 586 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,261,757 Number of Sequences: 59808 Number of extensions: 163243 Number of successful extensions: 580 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -