BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0920 (593 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23630.1 68417.m03403 reticulon family protein (RTNLB1) weak ... 40 0.002 At5g41600.1 68418.m05054 reticulon family protein (RTNLB4) weak ... 38 0.004 At2g46170.1 68415.m05741 reticulon family protein (RTNLB5) weak ... 38 0.004 At3g61560.1 68416.m06895 reticulon family protein (RTNLB6) conta... 37 0.012 At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak... 36 0.015 At1g64090.1 68414.m07260 reticulon family protein (RTNLB3) weak ... 35 0.036 At4g11220.1 68417.m01818 reticulon family protein (RTNLB2) simil... 34 0.062 At3g10260.3 68416.m01230 reticulon family protein weak similarit... 34 0.062 At3g10260.2 68416.m01229 reticulon family protein weak similarit... 34 0.062 At3g10260.1 68416.m01228 reticulon family protein weak similarit... 34 0.062 At3g18260.1 68416.m02323 reticulon family protein (RTNLB9) weak ... 34 0.082 At2g15280.1 68415.m01742 reticulon family protein (RTNLB10) low ... 33 0.19 At4g01230.1 68417.m00162 reticulon family protein (RTNLB7) weak ... 31 0.58 At2g37740.1 68415.m04629 zinc finger (C2H2 type) family protein ... 28 4.1 At3g10915.2 68416.m01315 reticulon family protein low similarity... 28 5.4 At3g10915.1 68416.m01314 reticulon family protein low similarity... 28 5.4 >At4g23630.1 68417.m03403 reticulon family protein (RTNLB1) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon Length = 275 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 491 LWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LW L+ +G CFN +TL + + LFT+P AY+ Sbjct: 201 LWVLSILGGCFNFLTLAYIALVLLFTVPLAYD 232 >At5g41600.1 68418.m05054 reticulon family protein (RTNLB4) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251, SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 257 Score = 38.3 bits (85), Expect = 0.004 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 491 LWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LW L+ +G+C+N +TL + LFT+P YE Sbjct: 180 LWVLSIIGSCYNFLTLFYTATVLLFTIPVLYE 211 >At2g46170.1 68415.m05741 reticulon family protein (RTNLB5) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon Length = 255 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = +2 Query: 434 LRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LR + L DL L V LW ++ VG FN +TL+ + ++ L T+P YE Sbjct: 161 LRSIALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLYE 211 >At3g61560.1 68416.m06895 reticulon family protein (RTNLB6) contains Pfam profile PF02453: Reticulon Length = 253 Score = 36.7 bits (81), Expect = 0.012 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = +2 Query: 434 LRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LR + L DL L LW ++ VG FN +TL+ + ++ L T+P YE Sbjct: 161 LRSIALGRDLKKFLMVVFGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYE 211 >At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak similarity to neuroendocrine-specific protein C [Homo sapiens] GI:307311; identical to cDNA RTNLB11 GI:32331878 Length = 200 Score = 36.3 bits (80), Expect = 0.015 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 473 LKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 L+ ++LW ++YVG N +TL+ +G + + P YE Sbjct: 128 LQVSLVLWAISYVGTLINSLTLVYIGVLLSLSFPIVYE 165 >At1g64090.1 68414.m07260 reticulon family protein (RTNLB3) weak similarity to SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 255 Score = 35.1 bits (77), Expect = 0.036 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 491 LWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LW L+ VG+ N +TLI + + LFT+P YE Sbjct: 176 LWVLSKVGSSCNFLTLIYIATVLLFTIPVLYE 207 >At4g11220.1 68417.m01818 reticulon family protein (RTNLB2) similar to SP|Q64548 Reticulon 1 (Neuroendocrine-specific protein) {Rattus norvegicus}; contains Pfam profile PF02453: Reticulon Length = 271 Score = 34.3 bits (75), Expect = 0.062 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 434 LRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LR + D+ L LW L+ +G C++ +TL + + LFT+P Y+ Sbjct: 178 LREIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYD 228 >At3g10260.3 68416.m01230 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 267 Score = 34.3 bits (75), Expect = 0.062 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 491 LWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LW VG+C N +T++ +G++ T+P YE Sbjct: 193 LWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYE 224 >At3g10260.2 68416.m01229 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 247 Score = 34.3 bits (75), Expect = 0.062 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 491 LWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LW VG+C N +T++ +G++ T+P YE Sbjct: 173 LWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYE 204 >At3g10260.1 68416.m01228 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 247 Score = 34.3 bits (75), Expect = 0.062 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 491 LWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LW VG+C N +T++ +G++ T+P YE Sbjct: 173 LWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYE 204 >At3g18260.1 68416.m02323 reticulon family protein (RTNLB9) weak similarity to RTN2-C [Homo sapiens] GI:3435090; contains Pfam profile PF02453: Reticulon Length = 225 Score = 33.9 bits (74), Expect = 0.082 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = +2 Query: 485 VLLWCLTYVGACFNGITLIILGWIALFTLPKAYEM 589 + L+ ++ +G FN + L+ +G++++ TLP YEM Sbjct: 149 ISLYIVSIIGTYFNFVNLLFIGFVSMQTLPVMYEM 183 >At2g15280.1 68415.m01742 reticulon family protein (RTNLB10) low similarity to neuroendocrine-specific protein C [Homo sapiens] GI:307311, SP|Q64548 Reticulon 1 (Neuroendocrine-specific protein) {Rattus norvegicus}; contains Pfam profile PF02453: Reticulon Length = 201 Score = 32.7 bits (71), Expect = 0.19 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = +2 Query: 437 RRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 R +++ + + V+LW +++VG N +T++ LG + +P YE Sbjct: 108 REIYVGRNAKQLFRVSVVLWTVSFVGNFLNFLTILYLGVVLSLLIPFLYE 157 >At4g01230.1 68417.m00162 reticulon family protein (RTNLB7) weak similarity to SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 242 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/51 (25%), Positives = 30/51 (58%) Frame = +2 Query: 434 LRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 586 LR + L D+ + + + LW ++ +G F+ ++L+ + ++ + T+P YE Sbjct: 158 LRSIALERDIKNFVMAVIGLWLVSVIGNWFSFLSLLYICFVLIHTVPMLYE 208 >At2g37740.1 68415.m04629 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 304 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 93 PSQHPRYAPSSTPWSR*ST 149 PS++ +Y PSS+PWS ST Sbjct: 157 PSKNSKYIPSSSPWSCPST 175 >At3g10915.2 68416.m01315 reticulon family protein low similarity to rS-Rex-s [Rattus norvegicus] GI:1143717, neuroendocrine-specific protein C [Homo sapiens] GI:307311; contains Pfam profile PF02453: Reticulon Length = 226 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 476 KFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAY 583 K + LW L+ +G+ + TL+ +G I T+P Y Sbjct: 148 KVVICLWLLSAIGSYISLCTLLYIGTILSVTIPALY 183 >At3g10915.1 68416.m01314 reticulon family protein low similarity to rS-Rex-s [Rattus norvegicus] GI:1143717, neuroendocrine-specific protein C [Homo sapiens] GI:307311; contains Pfam profile PF02453: Reticulon Length = 220 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 476 KFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAY 583 K + LW L+ +G+ + TL+ +G I T+P Y Sbjct: 142 KVVICLWLLSAIGSYISLCTLLYIGTILSVTIPALY 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,387,600 Number of Sequences: 28952 Number of extensions: 110138 Number of successful extensions: 440 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -