BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0918 (531 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.02 |apl2||AP-1 adaptor complex subunit Apl2 |Schizosacch... 29 0.33 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 29 0.33 SPAC5D6.13 ||SPAPJ735.02c|Golgi phosphoprotein 3 family|Schizosa... 27 2.3 SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 27 2.3 SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protei... 25 5.3 SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyce... 25 7.0 SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce... 25 9.3 SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 25 9.3 SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe... 25 9.3 >SPBC947.02 |apl2||AP-1 adaptor complex subunit Apl2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 29.5 bits (63), Expect = 0.33 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 31 VKCLGDIAFVLIKTIADMKCLTIAALLFVAGLS-IAEKYTDKYDNIDVDEILENRKLLVP 207 +KCLGD+A + I D C++I ++ +S + ++ T + + + + + LL+P Sbjct: 376 IKCLGDVALKVPSVIND--CISIFLEIYELNISYMVQEVTVVMETV-LRKYPQKIDLLLP 432 Query: 208 YIKCVLDE 231 Y+ V++E Sbjct: 433 YLSRVIEE 440 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 29.5 bits (63), Expect = 0.33 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +1 Query: 208 YIKCVLDEGRCTPDGKELKAHIK-DGMQTACAKCTDKQKVSARKIVKHIK--QHEADYWE 378 +I CVL +G + K +G Q C C D K +++KH+K + E+ Y + Sbjct: 1336 HISCVLTQGAYIDLISCITKFAKLNGNQKFCLSCVDMLKNLEHELIKHLKHMKKESVYSK 1395 Query: 379 QMKAKY 396 +++ +Y Sbjct: 1396 KLEEEY 1401 >SPAC5D6.13 ||SPAPJ735.02c|Golgi phosphoprotein 3 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 26.6 bits (56), Expect = 2.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 298 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKD 408 A +D+++ R V H K H Y + K +DPKD Sbjct: 12 AASSDEERPEMRS-VSHSKSHLEGYDDDHKIAFDPKD 47 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 26.6 bits (56), Expect = 2.3 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = -2 Query: 164 MLSYLSVYFSAIDKPATNKSAAIVRHFMSAM 72 +++ LSVY+S + +K +V+HFM+++ Sbjct: 540 LMNCLSVYYSKYFEGKDSKKFTLVKHFMNSL 570 >SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 945 Score = 25.4 bits (53), Expect = 5.3 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 40 LGDIAFVLIKTIADMKCLTIAALLFVAGLSIAEKYTDKYDNID-VDEILENRKLL 201 L + V IK + + F+ ++I EKY + YD+++ VDE ++ ++ Sbjct: 710 LNTLGPVTIKLACGTEFSFMKPACFLKNVAIGEKYVEPYDHMEIVDETTGDKAVI 764 >SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyces pombe|chr 3|||Manual Length = 1008 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 320 RCQPERSLNTLSSTKLITGSR*RPNMIPKMNSK 418 + PE ++S T+ T + P+ +PKMN K Sbjct: 432 KVNPEPHSESISDTRPSTPRKVPPSTVPKMNPK 464 >SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1666 Score = 24.6 bits (51), Expect = 9.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 139 KYTDKYDNIDVDEILE 186 +Y DK D DVDEI E Sbjct: 1038 EYIDKLDKYDVDEIAE 1053 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 24.6 bits (51), Expect = 9.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 410 SSLGSYLAFICSQ*SASCCLMCLTI 336 S + SYL FI S C +CL I Sbjct: 218 SEIRSYLEFILSNLDLECLTLCLKI 242 >SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 24.6 bits (51), Expect = 9.3 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +1 Query: 163 IDVDEILENRKLLVPYIKCVLDEGRCTPD--GKELKAHIKD 279 I D IL+ + P I +LD+GR + G E KA K+ Sbjct: 644 IRTDTILDEEVPVDPLITSILDDGRWWEEMFGSERKAGFKE 684 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,194,109 Number of Sequences: 5004 Number of extensions: 42920 Number of successful extensions: 105 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 218398248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -