BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0915 (497 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63880.1 68414.m07234 disease resistance protein (TIR-NBS-LRR... 27 5.3 At3g27670.1 68416.m03455 expressed protein 27 7.0 >At1g63880.1 68414.m07234 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1017 Score = 27.5 bits (58), Expect = 5.3 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -1 Query: 206 LLQLNVHSSQIIINQEKTNILFKSTR*DIMILNNIKQVP 90 L++LN+HSSQ+ + T L + D+ N+KQ+P Sbjct: 608 LVELNMHSSQLEYLWQGTQPLKNLKKMDLSQSKNLKQLP 646 >At3g27670.1 68416.m03455 expressed protein Length = 1841 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 221 AICSSGKLNQLVSIKNLFVSIVKYA 295 AI +GK + +V IKNL VS + YA Sbjct: 1138 AIYRAGKKDAVVKIKNLIVSWIPYA 1162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,818,112 Number of Sequences: 28952 Number of extensions: 149101 Number of successful extensions: 255 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -