BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0914 (501 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pomb... 27 1.6 SPBC651.11c |apm3||AP-3 adaptor complex subunit Apm3 |Schizosacc... 26 3.7 SPCC790.02 |pep3|vps18, vps18|ubiquitin-protein ligase E3 |Schiz... 25 6.4 SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces ... 25 8.4 SPAC8C9.19 |||conserved fungal protein|Schizosaccharomyces pombe... 25 8.4 >SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 27.1 bits (57), Expect = 1.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 159 WGVKKKAHSGPTFLGTALFAPLYAHSN 79 WG K HS L T L A +AHS+ Sbjct: 108 WGTLNKDHSNAILLHTGLSASSHAHSH 134 >SPBC651.11c |apm3||AP-3 adaptor complex subunit Apm3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 425 Score = 25.8 bits (54), Expect = 3.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 168 IFLWGVKKKAHSGPTFLGTALFAPLYAHSN 79 I W VKK A + P + T APL +N Sbjct: 335 ILEWSVKKLAWTSPALVLTGFLAPLKKDAN 364 >SPCC790.02 |pep3|vps18, vps18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 900 Score = 25.0 bits (52), Expect = 6.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 392 VLMLLHDMDSTNISQCVKQI*TLFPFPII 306 +L L+ +DS N+ + K I TL+ FP + Sbjct: 162 LLELVLTLDSANLKRIEKSINTLYSFPFM 190 >SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 24.6 bits (51), Expect = 8.4 Identities = 13/55 (23%), Positives = 21/55 (38%) Frame = -1 Query: 168 IFLWGVKKKAHSGPTFLGTALFAPLYAHSNIFITYSIHQFYLSKNVFTSNPRARP 4 + LW + L A+F+ L +IF+ + F V+ P RP Sbjct: 161 LLLWSIVLAKPEKNMLLSAAIFSALICFKHIFLYVAPAYFVYLLRVYCFTPNFRP 215 >SPAC8C9.19 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 94 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 198 HIRNTIIVSIIFLWGVKKKAHSGP 127 H+ I S++F W V+KK S P Sbjct: 28 HLIGYITCSVLFSWLVRKKVISSP 51 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,166,275 Number of Sequences: 5004 Number of extensions: 45148 Number of successful extensions: 116 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -