BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0912 (611 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 43 2e-04 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 43 2e-04 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 43 2e-04 SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 42 5e-04 SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 41 7e-04 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 41 0.001 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 41 0.001 SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 37 0.015 SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_15952| Best HMM Match : TPR_1 (HMM E-Value=5.8e-11) 29 3.9 SB_16838| Best HMM Match : TolA (HMM E-Value=2) 28 5.2 SB_26015| Best HMM Match : ANATO (HMM E-Value=3.2) 28 5.2 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 28 6.9 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 28 6.9 SB_17708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_26444| Best HMM Match : CAP_GLY (HMM E-Value=1.2e-23) 28 6.9 SB_20040| Best HMM Match : DUF293 (HMM E-Value=2.9) 28 6.9 SB_50479| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_11328| Best HMM Match : PAN (HMM E-Value=7.1e-06) 27 9.1 SB_10476| Best HMM Match : Lactamase_B (HMM E-Value=7.4e-08) 27 9.1 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +1 Query: 430 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPR 149 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +1 Query: 430 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 326 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPR 383 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 463 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 + DV +Y PEEI K + + V +H + +E+ R F LP+G Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEG 59 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 463 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 + DV +Y PEEI K + + V +H + +E+ R F LP+G Sbjct: 245 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEG 293 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +1 Query: 430 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPR 149 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 463 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 + DV +Y PEEI K + + V +H + +E+ R F LP+G Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEG 59 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +1 Query: 430 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPR 149 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 463 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 + DV +Y PEEI K + + V +H + +E+ R F LP+G Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFALPEG 59 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +1 Query: 430 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPR 149 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 463 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 + DV +Y PEEI K + + V +H + +E+ R F LP+G Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFALPEG 59 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 41.5 bits (93), Expect = 5e-04 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +1 Query: 460 LRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 + DV+ + PE I V+ + N+LLV+A HE + + +NR+F+LP+ Sbjct: 100 MAIDVAGFPPESIKVQVLGNELLVNANHEVEHEGHYHAMHFNRQFVLPR 148 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 451 TLKL-RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 TL++ + DV +Y PEEI K + + V +H + + +E+ R F LP+G Sbjct: 6 TLEIAKLDVKEYRPEEISFKVENGVVKVQGRHVNEGEFGFELKEFRRTFTLPEG 59 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +1 Query: 442 DGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 D L DVS + PEE+ VK ++L V A+ E + R++NR F+LP+ Sbjct: 96 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTARQFNRHFVLPR 150 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 469 DVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 DV ++ PEEI K + K+ V +S+ +E+ R + LP+G Sbjct: 12 DVREFKPEEITCKVENGKIKVSGLQRHESEEGFDSKEFRRCYNLPEG 58 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +1 Query: 436 EGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 E + DV + PE I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 93 ESKDDKFSMAMDVKGFPPEAIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFILPR 149 Score = 35.5 bits (78), Expect = 0.034 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 463 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 + DV +Y PEEI K + + V +H + +E+ R F LP+G Sbjct: 12 KLDVREYRPEEISFKVENGVVKVQGRHVNEGPFGFELKEFRRTFTLPEG 60 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +1 Query: 442 DGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 606 D L DVS + PEE+ VK ++L V A+ E + R++NR F+LP+ Sbjct: 24 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTARQFNRHFVLPQ 78 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +1 Query: 436 EGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 609 EGD K DV Y PEEI +K ++ + KH+ + + E++R + LP G Sbjct: 36 EGD-KVEIATLDVKNYRPEEISLKVEHGRIKIDGKHKSEGEHGYETSEFHRSYNLPDG 92 >SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/57 (35%), Positives = 31/57 (54%) Frame = +1 Query: 217 IDTEFSSIRERFDAEMRKMEEEMSKFRSELMNRESNNFFKXXXXXXXXXQHSDSRQL 387 ++ E SS+RE DA RKM ++SK +L +E+N + QHSD+ +L Sbjct: 255 LEKEISSLREIVDARERKM-VQLSKDNIDL--QETNAILRSQLEQLESMQHSDNAEL 308 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 29.5 bits (63), Expect = 2.2 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +3 Query: 171 WSQEKYPHQAWRFFGYRY-RILKHQRALRCRNEEDGRRNEQIQI-RTHEQRKQQFLQE 338 W Q+ PH GYRY + +KH + R R + Q+QI R E+RKQ L + Sbjct: 127 WQQKYGPHYKKLDLGYRYLKRIKHVSFDQIRE----RASAQLQIERERERRKQDLLMK 180 >SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 15 NSARGWTTNDQYCLVSRRVRIIP 83 +S GW TN Y +SR VR+IP Sbjct: 986 HSLEGWITNAVYTGISRIVRVIP 1008 >SB_15952| Best HMM Match : TPR_1 (HMM E-Value=5.8e-11) Length = 672 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +1 Query: 172 GLKRNIPIKLGDFSVIDTEFSSIRERFDAEMRKMEEEMSKFRSELMNRES 321 G K+N K S D+ S++ FD+E K+ E FR++ NR+S Sbjct: 52 GKKKNGAAKGKIVSKSDSLRSALSFDFDSETEKIRREYEVFRAQQANRDS 101 >SB_16838| Best HMM Match : TolA (HMM E-Value=2) Length = 371 Score = 28.3 bits (60), Expect = 5.2 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 144 ANNVKNG*QWSQEKYPHQAWRFFGYRYRIL-KHQRALRCRNEEDGRRNEQIQIRTHEQRK 320 + N N Q Q+K Q R + Y + K Q+ + R ++ +R +Q Q +QR+ Sbjct: 28 SRNNSNNVQLQQQKRQQQQKRTYNYDIQQQQKRQQQQQKRQQQKQKRQQQEQKLQQQQRR 87 Query: 321 QQ 326 QQ Sbjct: 88 QQ 89 >SB_26015| Best HMM Match : ANATO (HMM E-Value=3.2) Length = 474 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -1 Query: 200 SLMGIFLLRPLSAIFHVICRVEIVETKQTLKRSRVNTFHWNNTHSTADKT 51 SL GI LL + + I ++E +E + KR R + +W+ TH + T Sbjct: 412 SLAGIVLLN--TQLLCCIVKLEKMEKGRAQKRKRKRSNYWDTTHQESTDT 459 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 373 DSRQLAEPSHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPEE 495 DS + E + WD+ + D+GD KT++ D S Y E Sbjct: 1566 DSHEGKEKNEWDNYDGD--NDDGDSKTIEANKDKSVYHHSE 1604 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 198 AWRFFGYRYRILKHQRALRCRNEEDGRRNEQIQIRTHEQR 317 +WR G + +L+ + + CRN+ R EQI +R H R Sbjct: 592 SWRL-GTSFFLLEDGKVI-CRNDYGDRDEEQIVLRVHHMR 629 >SB_17708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 56 KTVLIISRPPSCRIPAA 6 K L +SRPPSC +P A Sbjct: 25 KVSLFVSRPPSCEVPLA 41 >SB_26444| Best HMM Match : CAP_GLY (HMM E-Value=1.2e-23) Length = 1024 Score = 27.9 bits (59), Expect = 6.9 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = +1 Query: 136 STRQIT*KMADSGLKRNIPIK----LGDFSVIDTEFSSIRERFDAEMRKMEEEMSKFRSE 303 S R+I K DS KR I + + DF V E S+ + D EMRK + + + + Sbjct: 551 SNREIQEKQEDSE-KRLIDLPPTPDIMDFKVKSAEIKSLAKSVDNEMRKFQVQQANEHIK 609 Query: 304 LMN 312 ++N Sbjct: 610 MLN 612 >SB_20040| Best HMM Match : DUF293 (HMM E-Value=2.9) Length = 646 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 427 IQDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYN 585 IQ G+T ++ S+Y E V +DN+ ++ +K EE K+V E++ Sbjct: 57 IQIVSQGETFRVFDGSSRYIGEAEVTTILDNQQILGSKMEESGLNKTVTVEFD 109 >SB_50479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 56 KTVLIISRPPSCRIPAA 6 K L +SRPPSC +P A Sbjct: 33 KMSLFVSRPPSCEVPLA 49 >SB_11328| Best HMM Match : PAN (HMM E-Value=7.1e-06) Length = 435 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -1 Query: 116 TLKRSRVNTFHWNNTHSTADKTVLIISRPPSCR 18 T S+V H NN H T +I PP C+ Sbjct: 169 TRAESKVKCAHKNNDHPTTIVNAIITHNPPICQ 201 >SB_10476| Best HMM Match : Lactamase_B (HMM E-Value=7.4e-08) Length = 866 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = +2 Query: 488 PKRSLLRLSTTNYWSMPNTRRNL 556 P+RS+ R++ +YW+ PN+ ++L Sbjct: 58 PRRSVFRVTCRHYWNGPNSCQSL 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,989,801 Number of Sequences: 59808 Number of extensions: 309578 Number of successful extensions: 1387 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1387 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -