BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0910 (591 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 1.8 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.2 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.2 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.2 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 24 4.2 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 7.4 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 9.8 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.8 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 1.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 173 SK*PYSCLANGKPPPRLGCRHP 108 +K P SC +N PPP C P Sbjct: 447 AKLPISCSSNSIPPPSNHCSSP 468 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 24.2 bits (50), Expect = 3.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 323 FHRTVLHLHHRDEQLSGH 270 FH L+++ RD+ LSGH Sbjct: 103 FHDRGLYVNERDDPLSGH 120 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 234 RWCQLLNTPVLSVT*KLLVPMVKVQYSSMKGLRLHLP 344 RW L + T +P V+ +Y +M+G R +P Sbjct: 2 RWTWGLLLFFVGQTVAYTIPAVRFEYPTMRGFRASIP 38 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 234 RWCQLLNTPVLSVT*KLLVPMVKVQYSSMKGLRLHLP 344 RW L + T +P V+ +Y +M+G R +P Sbjct: 2 RWTWGLLLFFVGQTVAYTIPAVRFEYPTMRGFRASIP 38 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 234 RWCQLLNTPVLSVT*KLLVPMVKVQYSSMKGLRLHLP 344 RW L + T +P V+ +Y +M+G R +P Sbjct: 2 RWTWGLLLFFVGQTVAYTIPAVRFEYPTMRGFRASIP 38 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 23.8 bits (49), Expect = 4.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 137 PPPRLGCRHPVRSVPT 90 PPP +G R P VPT Sbjct: 110 PPPMMGMRPPPMMVPT 125 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 7.4 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 586 LTCVQESRWETSDLISNTNDVLSVQSLQDTARFISH 479 L C E E +L +D +Q L+D F+S+ Sbjct: 621 LNCPVELSIENHNLTVIASDGFGIQPLEDLGSFVSY 656 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +3 Query: 234 RWCQLLNTPVLSVT*KLLVPMVKVQYSSMKGLRLHLP 344 RW L + T +P ++ +Y +M+G R +P Sbjct: 2 RWTWGLLLFFVGQTVAYTIPALRFEYPTMRGFRASIP 38 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +3 Query: 234 RWCQLLNTPVLSVT*KLLVPMVKVQYSSMKGLRLHLP 344 RW L + T +P ++ +Y +M+G R +P Sbjct: 2 RWTWGLLLFFVGQTVAYTIPALRFEYPTMRGFRASIP 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,828 Number of Sequences: 2352 Number of extensions: 15223 Number of successful extensions: 77 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -