BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0910 (591 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial... 71 6e-13 At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast... 61 5e-10 At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast... 55 3e-08 At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associate... 29 2.3 At5g19130.2 68418.m02277 GPI transamidase component family prote... 29 3.1 At5g19130.1 68418.m02276 GPI transamidase component family prote... 29 3.1 At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein con... 28 4.1 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 28 4.1 At2g36670.1 68415.m04497 aspartyl protease family protein contai... 28 4.1 At2g13790.1 68415.m01522 leucine-rich repeat family protein / pr... 28 4.1 At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like fami... 28 5.4 At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein con... 28 5.4 At4g21050.1 68417.m03044 Dof-type zinc finger domain-containing ... 27 7.1 At3g21200.1 68416.m02679 expressed protein 27 7.1 At5g37920.1 68418.m04568 hypothetical protein contains Pfam PF04... 27 9.4 At2g13800.1 68415.m01523 leucine-rich repeat family protein / pr... 27 9.4 >At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial (ATPC) identical to SP|Q96250 ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase Length = 325 Score = 70.9 bits (166), Expect = 6e-13 Identities = 46/147 (31%), Positives = 81/147 (55%), Gaps = 2/147 (1%) Frame = +2 Query: 155 RNMATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEV 334 R+++T + + R+KSVKNIQKIT++MKMV+A+K + + +R + F Sbjct: 41 RSIST-QVVRNRMKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQ---PFTALLGD 96 Query: 335 TPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIR--NRLSEPGAENIKVICVGDKSRGILQ 508 P D K + V ++SD+GLCG +++ V KV R +L+ + ++ + VG+K++ I+ Sbjct: 97 NPSIDVKKSVVVTLSSDKGLCGGINSTVVKVSRALYKLNAGPEKEVQFVIVGEKAKAIMF 156 Query: 509 RLYGKHIISVANEIGRLPPTFLDASQL 589 R I+ E+ + P + S L Sbjct: 157 RDSKNDIVLSVTELNKNPLNYAQVSVL 183 >At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast (ATPC1) identical to SP|Q01908 ATP synthase gamma chain 1, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana} Length = 373 Score = 61.3 bits (142), Expect = 5e-10 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 14/132 (10%) Frame = +2 Query: 164 ATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEVTPP 343 A+L+ + R+ SVKN QKIT++MK+V+AAK RA+ + RP+ E V+ Sbjct: 51 ASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNINEQLQ 110 Query: 344 EDD-----------PKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIK--VICVG 484 DD K V +T DRGLCG + + K R+ E ++ VI VG Sbjct: 111 TDDVDVPLTKVRPVKKVALVVVTGDRGLCGGFNNFIIKKAEARIKELKGLGLEYTVISVG 170 Query: 485 DKSRG-ILQRLY 517 K L+R Y Sbjct: 171 KKGNSYFLRRPY 182 >At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast (ATPC2) identical to SP|Q01909 ATP synthase gamma chain 2, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase; similar to ATP synthase gamma-subunit GI:21241 from [Spinacia oleracea] Length = 386 Score = 55.2 bits (127), Expect = 3e-08 Identities = 42/129 (32%), Positives = 62/129 (48%), Gaps = 13/129 (10%) Frame = +2 Query: 164 ATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ-FYERAEVTP 340 A ++ + R+ SVKN QKIT++M++V+AA+ RA+ + RP+ E V+ Y + Sbjct: 61 AGIRELRERIDSVKNTQKITEAMRLVAAARVRRAQDAVIKGRPFTETLVEILYSINQSAQ 120 Query: 341 PEDDPKQL----------FVAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIK--VICVG 484 ED L V +T D+GLCG + V+K R+ E I VI VG Sbjct: 121 LEDIDFPLSIVRPVKRVALVVVTGDKGLCGGFNNAVTKKATLRVQELKQRGIDCVVISVG 180 Query: 485 DKSRGILQR 511 K R Sbjct: 181 KKGNAYFSR 189 >At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associated receptor kinase 1 (BAK1) / somatic embryogenesis receptor-like kinase 3 (SERK3) identical to SP|Q94F62 BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor (EC 2.7.1.37) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) {Arabidopsis thaliana}; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 3 (SERK3) GI:14573458 Length = 615 Score = 29.1 bits (62), Expect = 2.3 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 4/93 (4%) Frame = +2 Query: 320 ERAEVTPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGA---ENIKVICVGDK 490 ER E PP D PK+ +A+ S RGL K+I + E + + VGD Sbjct: 377 ERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAV-VGDF 435 Query: 491 SRGILQRLYGKHI-ISVANEIGRLPPTFLDASQ 586 L H+ +V IG + P +L + Sbjct: 436 GLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGK 468 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 543 LATLMMCFPYNLCRIPRDLSPTQITLMFSAPGSLRRLRITLDTPVCT 403 L ++ PY +C++P SPT ++M+ S L + P C+ Sbjct: 508 LGFIVTLLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 554 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 543 LATLMMCFPYNLCRIPRDLSPTQITLMFSAPGSLRRLRITLDTPVCT 403 L ++ PY +C++P SPT ++M+ S L + P C+ Sbjct: 511 LGFIVTLLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 557 >At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 534 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 559 ETSDLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRFAETVADHFGY 416 E S ++ N+ D + + TARF++H H+D+ RF T H Y Sbjct: 327 EQSMMLQNSFDFIGINYY--TARFVAHDLHVDLSRPRF--TTDQHLQY 370 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 462 FSAPGSLRRLRITLDTPVCTAPHKPLSEVIATNNCLGSS 346 F APGSL +T P+C++ + + + NN G S Sbjct: 147 FDAPGSLTAGSVTCSDPICSSVFQTTAAQCSENNQCGYS 185 >At2g36670.1 68415.m04497 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 512 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 462 FSAPGSLRRLRITLDTPVCTAPHKPLSEVIATNNCLGSS 346 F APGSL +T P+C++ + + + NN G S Sbjct: 152 FDAPGSLTAGSVTCSDPICSSVFQTTAAQCSENNQCGYS 190 >At2g13790.1 68415.m01522 leucine-rich repeat family protein / protein kinase family protein Length = 620 Score = 28.3 bits (60), Expect = 4.1 Identities = 25/93 (26%), Positives = 37/93 (39%), Gaps = 4/93 (4%) Frame = +2 Query: 320 ERAEVTPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGA---ENIKVICVGDK 490 ER E P D PK+ +A+ S RGL K+I + E + + VGD Sbjct: 382 ERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKIIHRDVKAANILLDEEFEAV-VGDF 440 Query: 491 SRGILQRLYGKHI-ISVANEIGRLPPTFLDASQ 586 L H+ +V IG + P +L + Sbjct: 441 GLAKLMNYNDSHVTTAVRGTIGHIAPEYLSTGK 473 >At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like family protein contains Pfam profile PF04091: Exocyst complex subunit Sec15-like Length = 771 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 Query: 490 FISHTDHLDVLSTRFAETVADHFGYTSVYSSAQTSVRGHSNKQLLG 353 F H HL + R AE HF T ++A+ ++ G K++ G Sbjct: 536 FFRHAAHLSGVPLRMAERGRRHFPLTKSQNTAEDTLSGMLKKKIDG 581 >At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to Cyanogenic Beta-Glucosidase (GI:1311386)(pdb:1CBG) [Trifolium Repens]; identical beta-glucosidase GI:10834547 Length = 577 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 559 ETSDLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRF 446 E S ++ N++D + + TARF +H H+D RF Sbjct: 321 EQSKMLQNSSDFVGINYY--TARFAAHLPHIDPEKPRF 356 >At4g21050.1 68417.m03044 Dof-type zinc finger domain-containing protein PBF protein, Triticum aestivum, EMBL:AJ012284 Length = 210 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -3 Query: 553 SDLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRFAETVADHFGYTS 410 S+++S N ++ QS + T D S+ V +HFGY S Sbjct: 87 SEMVSVENQPINHQSFRQTQENNEFVRSFDASSSATVTAVPNHFGYLS 134 >At3g21200.1 68416.m02679 expressed protein Length = 317 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 459 SAPGSLR-RLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGGVTSALS 319 S P SLR + TLDTP + HKP + + + + SS G S L+ Sbjct: 35 SRPISLRCSVSTTLDTPATASTHKPFPAEV-SRSIMELSSVGTLSTLT 81 >At5g37920.1 68418.m04568 hypothetical protein contains Pfam PF04510 : Family of unknown function (DUF577)); common family comprised of At5g37410, At5g37400, At5g37920, At5g37460, At5g37650, At5g37470, At5g37420, At5g37430 contains Pfam PF04510 : Family of unknown function (DUF577) Length = 609 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -3 Query: 547 LISNTNDVLSVQSLQDTARFISHTDHL---DVLSTRFAETVADHFGYTS 410 L+ N N++ V+ LQD RF+S +L + RF T G S Sbjct: 243 LVDNGNEMFLVRVLQDFERFVSRDMNLYKYSEVQCRFVSTFVSQIGKLS 291 >At2g13800.1 68415.m01523 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 601 Score = 27.1 bits (57), Expect = 9.4 Identities = 25/93 (26%), Positives = 37/93 (39%), Gaps = 4/93 (4%) Frame = +2 Query: 320 ERAEVTPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGA---ENIKVICVGDK 490 ER E P D PK+ +A+ S RGL K+I + E + + VGD Sbjct: 363 ERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKIIHLDVKAANILLDEEFEAV-VGDF 421 Query: 491 SRGILQRLYGKHI-ISVANEIGRLPPTFLDASQ 586 L H+ +V IG + P +L + Sbjct: 422 GLAKLMNYNDSHVTTAVRGTIGHIAPEYLSTGK 454 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,416,248 Number of Sequences: 28952 Number of extensions: 318912 Number of successful extensions: 815 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -