BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0906 (446 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 155 2e-38 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.015 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.035 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 34 0.047 SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 32 0.19 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 32 0.25 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.76 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 29 1.8 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 1.8 SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4879| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 29 2.3 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 29 2.3 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_20291| Best HMM Match : ATP-synt_ab (HMM E-Value=0) 28 3.1 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 3.1 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 28 3.1 SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 28 4.0 SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) 28 4.0 SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) 27 5.3 SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) 27 5.3 SB_4536| Best HMM Match : Krr1 (HMM E-Value=4) 27 5.3 SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) 27 5.3 SB_54446| Best HMM Match : PilO (HMM E-Value=2.9) 27 7.1 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 27 7.1 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 27 7.1 SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) 27 7.1 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 27 7.1 SB_15828| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 27 7.1 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_41024| Best HMM Match : DIL (HMM E-Value=1.3e-30) 27 7.1 SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) 27 7.1 SB_11923| Best HMM Match : Toxin_3 (HMM E-Value=0.32) 27 7.1 SB_22161| Best HMM Match : Vicilin_N (HMM E-Value=0.11) 27 9.3 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 27 9.3 SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_13875| Best HMM Match : rve (HMM E-Value=4.5e-15) 27 9.3 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 155 bits (376), Expect = 2e-38 Identities = 89/123 (72%), Positives = 93/123 (75%), Gaps = 1/123 (0%) Frame = +3 Query: 81 MATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 260 MA TLEDK+IW DGEE + EEVLRM TDEIVSR RLLDNEI Sbjct: 1 MAATLEDKAIWGDGEE-MGEEVLRMSTDEIVSRARLLDNEI------------------- 40 Query: 261 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQE-EEEDGAVVDLDSQRKGKCAVIKTSTRQ 437 KEN+EKIKVNKTLPYLVSNVIELLDVDPQ+ EEDGA VDLDSQRKGKCAVIKTSTRQ Sbjct: 41 --KENSEKIKVNKTLPYLVSNVIELLDVDPQDYAEEDGANVDLDSQRKGKCAVIKTSTRQ 98 Query: 438 TYF 446 TYF Sbjct: 99 TYF 101 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 35.9 bits (79), Expect = 0.015 Identities = 30/128 (23%), Positives = 60/128 (46%), Gaps = 2/128 (1%) Frame = +3 Query: 57 EKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI--MKSEVMR 230 +K+ I + L D W+D +L EV ++ D+ + +++D+E ++ ++S + + Sbjct: 2590 DKSTATIHLEVELSD---WKDQASSLQSEVAQLKKDKAAAMHKVIDSEEQMIQLRSRLYK 2646 Query: 231 ISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKC 410 L D +K + K N L + + L V E ++ +VD + + K KC Sbjct: 2647 TEDSLVRNQDTVKLLS---KENTDLRVEIERLRSRLSVYASETAKE--IVDGNGEGKAKC 2701 Query: 411 AVIKTSTR 434 V+ T T+ Sbjct: 2702 GVV-TKTK 2708 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 34.7 bits (76), Expect = 0.035 Identities = 20/84 (23%), Positives = 46/84 (54%), Gaps = 2/84 (2%) Frame = +3 Query: 162 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK-TLPYLVSNVIELL 338 + + S R +NEI +K+ + R+ EL++ +++ ++EKI ++ + L ++ + Sbjct: 105 ESVTSELRGRENEIAELKTSIGRLESELRSLKSELQNSSEKISEDEHEISQLKNDKARCM 164 Query: 339 -DVDPQEEEEDGAVVDLDSQRKGK 407 ++ + E+ + VVDL RK + Sbjct: 165 QELRDEREKSNKLVVDLQKTRKAQ 188 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 34.3 bits (75), Expect = 0.047 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 4/100 (4%) Frame = +3 Query: 99 DKSIWEDGEEALSEEVLRMPT--DEIVSRTRLLDNEIKIMKSE--VMRISHELQAQNDKI 266 D+ WE+ ++ L M T DE + + E K E + + ++ AQ +I Sbjct: 391 DREEWEEEQKRLDRAWYDMDTGYDETQNPFADVSEEYTKKKEEKLIKKAVKKMSAQQRQI 450 Query: 267 KENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL 386 ++ + + N+ L S V++ LDVD EEE+ A V L Sbjct: 451 NKDNDMWETNRML---TSGVVQKLDVDEDFEEENEAKVHL 487 >SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 748 Score = 33.1 bits (72), Expect = 0.11 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 3/115 (2%) Frame = +3 Query: 66 NHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 245 N NIT E I +DG+E E++ PT + +L DN ++ E +L Sbjct: 585 NMNITFKAHREVNRIEQDGQEVQEEQLEDNPTVPLGQEEQLEDNPTVPLEQE-----EQL 639 Query: 246 QAQNDKIKENTEKIKVNKTLPYLVSNVIE---LLDVDPQEEEEDGAVVDLDSQRK 401 + E ++++ N T+P +E + ++ +E+ ED V L+ + + Sbjct: 640 EDNPTVPLEQEQQLEDNPTVPLEQEEQLEDNPTVPLEQEEQLEDNPTVPLEQEEQ 694 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 33.1 bits (72), Expect = 0.11 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +3 Query: 219 EVMRISHELQAQNDKIKENTEKIK-VNKTLPYLVSNVIELLD 341 E+ + +EL+ Q + IKEN EK+K K + L +IEL D Sbjct: 612 EITELENELEEQREIIKENEEKLKEKEKEIEKLKKKIIELSD 653 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +3 Query: 189 LDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVI---ELLDVDPQ 353 ++NE K+ ++ V ++H+L + D E E I++ PY + +V+ EL+ V P+ Sbjct: 191 VENEEKVYEALVRWVNHDLSQRRDLFPELLELIRLPLVSPYYLVDVVEKEELMTVSPR 248 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 31.9 bits (69), Expect = 0.25 Identities = 25/107 (23%), Positives = 54/107 (50%), Gaps = 2/107 (1%) Frame = +3 Query: 93 LEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 272 + ++ + E+ E EE +++ + + E+++M + + HE + +++IKE Sbjct: 2909 ISEEELLEEVEVQRVEEGASHDLEDVPALKESYEEEVEVM---AVGLKHEERVNDEEIKE 2965 Query: 273 NTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL--DSQRKGK 407 EKI +++ N+I+ L+ +EE E AV + +R+GK Sbjct: 2966 KDEKIHLDE------ENIIQDLEETFEEELEVSAVETSKNEDERRGK 3006 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 30.7 bits (66), Expect = 0.57 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 2/98 (2%) Frame = +3 Query: 114 EDGEEALSEEVL--RMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 287 EDG E L E++ R E+ R + L+ E +++ +V + ++ + KIK+ EK+ Sbjct: 408 EDGTE-LEEKIRSQRNRITELERRVKELEKEKNLLEQQVKTMKNKSDDDDKKIKDLNEKV 466 Query: 288 KVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRK 401 +V + L N E+ + E + + DL + K Sbjct: 467 RVLE--KQLKENDAEIQGLKDDNERLEDELEDLSTTIK 502 Score = 30.3 bits (65), Expect = 0.76 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +3 Query: 162 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLD 341 DE++ + L ++ ++ EV ++ EL+ + ++TEK+ N + ++EL Sbjct: 716 DELMKQNESLRKKVSKLEDEVRFLNDELREADSSSIKDTEKL--NAEIREFKKKIVELEK 773 Query: 342 -VDPQEEE 362 VD QEEE Sbjct: 774 LVDDQEEE 781 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 30.7 bits (66), Expect = 0.57 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 9/109 (8%) Frame = +3 Query: 138 EEVLRMPTDEIVSR---TRLLDNEIKIMKSEVMRISHELQAQND------KIKENTEKIK 290 EE LR +E+ R LDNE+ ++++ +L+ D ++ E E+ K Sbjct: 909 EEKLRRTEEELKDRDGQVAKLDNELTKLQNDFQDTITQLKTLEDLLDTSKRVVEEKEQ-K 967 Query: 291 VNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQ 437 V + L +V EL D +E+DG + +LD K IK Q Sbjct: 968 VTELDKLLNESVDELQQKDKSLKEKDGKLAELDQALKESRKEIKNREAQ 1016 >SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 30.7 bits (66), Expect = 0.57 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +3 Query: 90 TLEDKSIWEDGEEALSEEVLRMPTDEIVSRTR-LLDNEIKIMKSEVMRISHELQAQNDKI 266 TL+D+ W + E + + + DE++S R + I I V I ++A Sbjct: 502 TLDDEQGWVEPEPEVDAKRSCLKDDELLSMVRNIKAAHITITGEPVPEIEERMRAMTTAS 561 Query: 267 KENTEKIKVN 296 EN E +K+N Sbjct: 562 NENKELVKLN 571 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 30.3 bits (65), Expect = 0.76 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 261 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQR 398 K+K ++ + NKT + N +E D +P+E EED V D++R Sbjct: 510 KLKSKMKRSEKNKTEELVAVNKVETDDDNPEETEEDSGNVS-DTER 554 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 29.1 bits (62), Expect = 1.8 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 14/94 (14%) Frame = +3 Query: 36 LNLKDYYEKTNHNITM-----ATTLEDKSIWED---GEEALSE---EVLRM---PTDEIV 173 LN KDY ++ N T+ LE+K + G + ++E E+ +M PT+ + Sbjct: 1593 LNNKDYIQQRTDNQTLRQENETVLLENKDLKAQIAAGLKKMAEYEREITKMGQRPTEVVK 1652 Query: 174 SRTRLLDNEIKIMKSEVMRISHELQAQNDKIKEN 275 R R D+EI+ E+ + EL+ Q ++EN Sbjct: 1653 RRGRRGDSEIQRENIELQKRIAELEIQRKSVEEN 1686 Score = 27.9 bits (59), Expect = 4.0 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +3 Query: 45 KDYYEKTNHNITMATTLEDKS--IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKS 218 +D YEK N + M +++ I + A + +L+ +E + + EIK ++S Sbjct: 1193 EDLYEKENEVVVMKKRVKEFELLISNSNDSAAKDSLLKTVKNE----NEIQEKEIKKLRS 1248 Query: 219 EVMRISHELQAQNDK 263 EV+ + E K Sbjct: 1249 EVLELQREASGAQGK 1263 >SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +3 Query: 123 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEK 284 + A+ E++ D VS R+ +NE+++ KSE + +Q K + E+ Sbjct: 121 QTAIQLEIVNFNDDSFVSGNRMSNNEVRVTKSESLSSPSNSYSQAFKSNNSREE 174 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 29.1 bits (62), Expect = 1.8 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +3 Query: 90 TLEDKSIWED---GEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 260 +LE+K +D E S E DE+V R L +E+K +K E + ++++ N Sbjct: 682 SLEEKIRLKDVVIDELKTSLETCSKERDELVESNRNLGSELKALKKENEELVSQVESLNQ 741 Query: 261 KIKE 272 K+++ Sbjct: 742 KVEQ 745 >SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 29.1 bits (62), Expect = 1.8 Identities = 23/86 (26%), Positives = 38/86 (44%) Frame = +3 Query: 45 KDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEV 224 K+ +KT N T E+K ++ ++ E + T E +T+ ++ K K + Sbjct: 458 KENKDKTKEN--KDKTKENKDKTKENKDKTKEN--KDKTKENKDKTKNNKDKTKENKDKT 513 Query: 225 MRISHELQAQNDKIKENTEKIKVNKT 302 + + DK KEN K K NKT Sbjct: 514 NENKDKTKENKDKTKENKNKTKENKT 539 >SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 28.7 bits (61), Expect = 2.3 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++D+ PQ+EEEDG V++ Sbjct: 527 DIVDLQPQDEEEDGEVIE 544 >SB_4879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 30 VLLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLR 152 ++ N + YE N + M + L+D E GEE EEV R Sbjct: 388 IINNNNNNYESDNSDTNMISDLDDDDDDESGEEEEEEEVNR 428 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 28.7 bits (61), Expect = 2.3 Identities = 32/146 (21%), Positives = 59/146 (40%), Gaps = 9/146 (6%) Frame = +3 Query: 30 VLLNLKDYYEKTNHN-ITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIK 206 +L+NL+ K + T LE + E L++ L M + + L+N ++ Sbjct: 790 LLVNLQSLQNKLERSEFETRTRLEGQVEALQKESNLAKRQLEMDNTHHKNLIKTLENRVQ 849 Query: 207 IMKSEVMRISHELQAQNDKIKENTEKI--------KVNKTLPYLVSNVIELLDVDPQEEE 362 +++++ S Q D + NT+++ +V L V ELL +P ++ Sbjct: 850 ELQTQIDTESRSNQQARDMLVRNTKEMERLEFKNTEVKAQLEAAEKRVHELLSKEPSSDQ 909 Query: 363 EDGAVVDLDSQRKGKCAVIKTSTRQT 440 D+D RK KT + T Sbjct: 910 ------DIDKMRKETEEKFKTDLQDT 929 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 28.7 bits (61), Expect = 2.3 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++D+ PQ+EEEDG V++ Sbjct: 982 DIVDLQPQDEEEDGEVIE 999 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.7 bits (61), Expect = 2.3 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++D+ PQ+EEEDG V++ Sbjct: 22 DIVDLQPQDEEEDGEVIE 39 >SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 192 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIE 332 D +K + SE ++ EL Q DKI KIK+ P + ++IE Sbjct: 104 DQPMKKLGSEFETVTGELLTQLDKISRGVRKIKLVSGDPRDIQSLIE 150 >SB_20291| Best HMM Match : ATP-synt_ab (HMM E-Value=0) Length = 475 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/75 (21%), Positives = 36/75 (48%) Frame = +3 Query: 24 VQVLLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEI 203 V +L N+ +Y+ H++ E+K W +E + + + + + + + + D E Sbjct: 396 VGMLSNIVAFYDMARHSVETTAQAENKVTWNVIKENMGDAIYALSSMKF--KDPIKDGEA 453 Query: 204 KIMKSEVMRISHELQ 248 KI K++ + +LQ Sbjct: 454 KI-KADFAELHEQLQ 467 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = +3 Query: 102 KSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTE 281 KS+ + G+ + DE+ R L+ E+K +KSE + Q N ++ Sbjct: 224 KSLKKGGDLLFPGASYKRKLDEVAGRLDELEREVKRLKSETCQTKMTCQPCNHQLLMVGP 283 Query: 282 KIKVNKTLP 308 + + TLP Sbjct: 284 TVPIPPTLP 292 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +3 Query: 114 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKI 266 ++ E L + LR E S+ + LD+E+ + + ++ HELQ + +I Sbjct: 910 QEAEFELKLDDLRADIQERDSQIKELDSEMAEVTENIAKLQHELQGKGQEI 960 >SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 153 MPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDK-IKENTEKIKVNKTLPYLVSNVI 329 M TD+ L+ ++ M SE++R+ + A++DK ++ E I+ L+ ++ Sbjct: 76 METDQANQSVSDLEGIVQSMGSEILRLQSLVSAEDDKMLRYKVENIRRKHNYIPLIMEML 135 Query: 330 ELL 338 +LL Sbjct: 136 KLL 138 >SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 27.9 bits (59), Expect = 4.0 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +3 Query: 108 IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 245 I E +E ++ R+ EI+S+T +L ++IK + VMRI E+ Sbjct: 196 IIEGKKEFKLADLGRVTLKEIISKTSVLVSDIKGSRESVMRIPMEI 241 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 159 TDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVN 296 T+++V + +EI I E ++ HE++ + +I TEK+ V+ Sbjct: 376 TNKVVHEVKGKVSEISIKTDETNKVVHEVKGKVSEISIKTEKMAVD 421 >SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) Length = 768 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 270 ENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 374 E ++ + ++T P N +E V P+ EEEDGA Sbjct: 56 EGEKEDEASETSPRGSENSVESRSVSPKNEEEDGA 90 >SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1399 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +3 Query: 336 LDVDPQEEEEDGAVVDLDSQRKGKCAVIKTS-TRQTY 443 +D P+E + DGAVV++ S +G V ++S +RQ+Y Sbjct: 477 MDEVPEEMDSDGAVVNIQSAMRGH--VTRSSLSRQSY 511 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 27.5 bits (58), Expect = 5.3 Identities = 24/101 (23%), Positives = 51/101 (50%), Gaps = 8/101 (7%) Frame = +3 Query: 12 ARGWVQVLLN-LKDYYEKTNHNITMATTLEDKSIWE--DGEEALSEEVLRMPTD---EIV 173 ARG++Q L + + + E + + +K+ W+ ++ +E+L + + EI Sbjct: 789 ARGYLQALASKMTEELEGLKSSGYSSLPRGEKNQWQMRRSQKVDKQEILSLQANLQAEIQ 848 Query: 174 SRTRLLD--NEIKIMKSEVMRISHELQAQNDKIKENTEKIK 290 ++T+L + N +K R E +AQN+ ++E +K+K Sbjct: 849 AKTQLSEELNRMKEANVTTERKLAESEAQNNSLREEIKKLK 889 >SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) Length = 528 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/51 (23%), Positives = 29/51 (56%) Frame = +3 Query: 138 EEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 290 E+ + +EI+ + IK+ + + R+ HE+Q +ND + ++ +++K Sbjct: 114 EDEIAQEKEEILELKNKHSDSIKLAE-DTNRLLHEVQRKNDSLAKDMKRVK 163 >SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = +3 Query: 192 DNEIKIMKSEVMRISHELQ---AQNDKIKENTEK 284 D++I+++KSE+ + S E+Q AQ D++K +K Sbjct: 274 DDQIQMLKSELEKASTEMQGIAAQVDEVKSQADK 307 >SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +3 Query: 114 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 272 + E+ + R P D V ++++ E+K+ K+ + H ++ D+ KE Sbjct: 309 QKSEKEVDASSERAPKDNKVRKSKIKTEELKVPKALEREVGHAKTSKKDESKE 361 >SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) Length = 94 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +3 Query: 189 LDNEIK----IMKSEVMRISHELQAQNDKIKENTEKIK 290 LD E++ +M E R++ ELQAQ DK+ ++++ Sbjct: 22 LDKELEWRRDVMNKEYTRLASELQAQEDKVLNMKQQVQ 59 >SB_4536| Best HMM Match : Krr1 (HMM E-Value=4) Length = 246 Score = 27.5 bits (58), Expect = 5.3 Identities = 20/75 (26%), Positives = 39/75 (52%) Frame = +3 Query: 177 RTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQE 356 R R L+ ++ MK E +A+ K+ ++ K V+ +P+ N++ELL DP++ Sbjct: 93 RKRQLNILLEKMKGERSLRQQLNKARKSKMLKSRSKRLVDLGVPH---NLLELLPEDPED 149 Query: 357 EEEDGAVVDLDSQRK 401 + +V+L R+ Sbjct: 150 AMPEEIIVELGRIRE 164 >SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) Length = 815 Score = 27.5 bits (58), Expect = 5.3 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 6/86 (6%) Frame = +3 Query: 96 EDKSIWEDGEEALSEEVLRMPTD------EIVSRTRLLDNEIKIMKSEVMRISHELQAQN 257 +DK I E+ + +EV + D E+V+R RL D E+ ++ + EL N Sbjct: 618 KDKYIQEELRQLSDKEVYKETKDLTQYITELVNR-RLSDKEVYKETKDLTQYITELV--N 674 Query: 258 DKIKENTEKIKVNKTLPYLVSNVIEL 335 ++++ + ++KTL YL+ NV ++ Sbjct: 675 RRVRKLSADGFIDKTLDYLIINVRDM 700 >SB_54446| Best HMM Match : PilO (HMM E-Value=2.9) Length = 261 Score = 27.1 bits (57), Expect = 7.1 Identities = 20/75 (26%), Positives = 39/75 (52%) Frame = +3 Query: 177 RTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQE 356 R R L+ ++ MK E +A+ K+ ++ K V+ +P+ N++ELL DP++ Sbjct: 76 RKRQLNILLEKMKGERSLRQQLNKARKSKMLKSRSKRLVDLGVPH---NLMELLPEDPED 132 Query: 357 EEEDGAVVDLDSQRK 401 + +V+L R+ Sbjct: 133 AMPEEIIVELGRIRE 147 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 123 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDK 263 +EA + +RM D+I+++ + L EI ++ M H L+ Q D+ Sbjct: 459 QEADHQSTIRMLQDQILAKEQRLVAEIAEVERSYMETEHMLREQLDE 505 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 27.1 bits (57), Expect = 7.1 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 2/87 (2%) Frame = +3 Query: 36 LNLKDYYEKTNHNIT--MATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI 209 L + +E T +++ +AT ++ K + EAL L+ ++ + L EI+ Sbjct: 189 LKAETQHESTLRDLSSQLATAVQQK----EELEALRARELKANREDYQKKCESLMVEIES 244 Query: 210 MKSEVMRISHELQAQNDKIKENTEKIK 290 +KSEV +++ LQ Q D+++ + +K Sbjct: 245 LKSEVQQLNSRLQNQ-DELETERKTLK 270 >SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) Length = 888 Score = 27.1 bits (57), Expect = 7.1 Identities = 8/18 (44%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++++ PQ+EEEDG V++ Sbjct: 684 DIVELQPQDEEEDGEVIE 701 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 27.1 bits (57), Expect = 7.1 Identities = 8/18 (44%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++D+ PQ++EEDG V++ Sbjct: 514 DIVDLQPQDKEEDGEVIE 531 >SB_15828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 578 Score = 27.1 bits (57), Expect = 7.1 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 24 VQVLLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEI 170 V V+++ YY HN ED EDGEEA EE + P D+I Sbjct: 381 VPVIVSNFAYYYSREHNKMNNNGDED----EDGEEADKEEDEQAPRDQI 425 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 27.1 bits (57), Expect = 7.1 Identities = 8/18 (44%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++D+ PQ++EEDG V++ Sbjct: 153 DIVDLQPQDKEEDGEVIE 170 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 27.1 bits (57), Expect = 7.1 Identities = 8/18 (44%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++D+ PQ++EEDG V++ Sbjct: 1041 DIVDLQPQDKEEDGEVIE 1058 Score = 27.1 bits (57), Expect = 7.1 Identities = 8/18 (44%), Positives = 16/18 (88%) Frame = +3 Query: 330 ELLDVDPQEEEEDGAVVD 383 +++D+ PQ++EEDG V++ Sbjct: 1111 DIVDLQPQDKEEDGEVIE 1128 >SB_41024| Best HMM Match : DIL (HMM E-Value=1.3e-30) Length = 1440 Score = 27.1 bits (57), Expect = 7.1 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +3 Query: 180 TRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEE 359 T LD E+K+ +V++ SH L D N + PY V++ +L V Sbjct: 631 THTLDKELKLHWLDVLQKSHALHKDGDYSVVNGDDQTDKIRFPYKVADEERMLQVVMGLV 690 Query: 360 EED 368 +ED Sbjct: 691 DED 693 >SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) Length = 899 Score = 27.1 bits (57), Expect = 7.1 Identities = 24/108 (22%), Positives = 51/108 (47%), Gaps = 3/108 (2%) Frame = +3 Query: 75 ITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQ 254 I +A T+E +++ E+ E +S + +R +N IK ++ + + + Sbjct: 631 IKLAETIEQRTLIEELELKISCSLTHNAWSYF-ARALSTNNSIKALQPYINKFNPNCDFI 689 Query: 255 NDKIKENTEKIKVNK---TLPYLVSNVIELLDVDPQEEEEDGAVVDLD 389 N +KENT K+N T+ Y++++ E + + +++DLD Sbjct: 690 NKVLKENTSIKKLNLFEITMSYVLAD--EFIAALAMTQLHKPSLIDLD 735 >SB_11923| Best HMM Match : Toxin_3 (HMM E-Value=0.32) Length = 884 Score = 27.1 bits (57), Expect = 7.1 Identities = 20/75 (26%), Positives = 39/75 (52%) Frame = +3 Query: 177 RTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQE 356 R R L+ ++ MK E +A+ K+ ++ K V+ +P+ N++ELL DP++ Sbjct: 659 RKRQLNILLEKMKGERSLRQQLNKARKSKMLKSRSKRLVDLGVPH---NLMELLPEDPED 715 Query: 357 EEEDGAVVDLDSQRK 401 + +V+L R+ Sbjct: 716 PMPEEIIVELGRIRE 730 >SB_22161| Best HMM Match : Vicilin_N (HMM E-Value=0.11) Length = 489 Score = 26.6 bits (56), Expect = 9.3 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 1/117 (0%) Frame = +3 Query: 54 YEKTNHNITMATTLEDKSIWEDGEEALSEEV-LRMPTDEIVSRTRLLDNEIKIMKSEVMR 230 Y++ ++ + LE K W + EEA + V L+ ++ + E M+ ++ Sbjct: 51 YKERERHMEIVQLLEKKRPWAEYEEARKQFVDLKTKREDAKKQLDQCRRENAPMEQQLNA 110 Query: 231 ISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRK 401 I L + +K+ EK S+ +E L VD EE+++ + D+ + K Sbjct: 111 IVQHLCQLDRNMKQQAEKGSETHRKAKAKSDQLEAL-VDKIEEQQN-HLKDMQDEEK 165 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +3 Query: 162 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLP 308 DE+ R L+ E+K +KSE + Q N ++ + + TLP Sbjct: 20 DEVAGRLDELEREVKRLKSETCQTKMTCQPCNHQLLMVGPTVPIPPTLP 68 >SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1622 Score = 26.6 bits (56), Expect = 9.3 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -1 Query: 251 SLQLVRDPHHFALHYFDFIVQKSGSTYDFISW 156 +L+ R + H F+F++++ Y F SW Sbjct: 325 TLKTARHDLEHSAHGFEFVIEQDSMLYGFCSW 356 >SB_13875| Best HMM Match : rve (HMM E-Value=4.5e-15) Length = 1216 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/70 (27%), Positives = 28/70 (40%) Frame = +3 Query: 3 RWRARGWVQVLLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRT 182 +W G+VQ DY K N + L D + DGEE + R+ + Sbjct: 827 KWMILGFVQDAAYNGDY-TKNPFNFQLEAKLSDIKVTVDGEETPYNALSRLDGKGVDLYH 885 Query: 183 RLLDNEIKIM 212 L DN + I+ Sbjct: 886 MLFDNVMSIV 895 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,094,210 Number of Sequences: 59808 Number of extensions: 182328 Number of successful extensions: 676 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -