BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0906 (446 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5... 132 1e-31 At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, put... 127 3e-30 At3g05130.1 68416.m00557 expressed protein ; expression supporte... 36 0.016 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 34 0.050 At4g27500.1 68417.m03950 expressed protein non-consensus GA dono... 32 0.20 At3g53540.1 68416.m05912 expressed protein 32 0.20 At5g27500.1 68418.m03287 hypothetical protein hypothetical prote... 31 0.27 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 30 0.62 At5g46410.1 68418.m05712 NLI interacting factor (NIF) family pro... 30 0.82 At4g08710.1 68417.m01439 hypothetical protein contains Pfam prof... 30 0.82 At2g30500.1 68415.m03715 kinase interacting family protein simil... 30 0.82 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 29 1.1 At5g07220.1 68418.m00823 BAG domain-containing protein contains ... 29 1.4 At5g58320.2 68418.m07301 kinase interacting protein-related low ... 29 1.9 At5g41780.1 68418.m05087 myosin heavy chain-related weak similar... 29 1.9 At3g24350.1 68416.m03057 syntaxin, putative (SYP32) similar to S... 29 1.9 At1g29000.1 68414.m03546 heavy-metal-associated domain-containin... 28 2.5 At5g06850.1 68418.m00774 C2 domain-containing protein contains I... 28 3.3 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 28 3.3 At2g05180.1 68415.m00545 cytochrome P450 family protein similar ... 28 3.3 At5g64330.1 68418.m08080 non-phototropic hypocotyl 3 (NPH3) iden... 27 4.4 At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein ... 27 4.4 At3g10180.1 68416.m01219 kinesin motor protein-related similar t... 27 4.4 At1g30960.1 68414.m03791 GTP-binding protein (ERG) identical to ... 27 4.4 At4g14760.1 68417.m02271 M protein repeat-containing protein con... 27 5.8 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 27 5.8 At3g04830.2 68416.m00524 expressed protein 27 5.8 At3g04830.1 68416.m00523 expressed protein 27 5.8 At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi... 27 7.6 At4g35610.1 68417.m05058 zinc finger (C2H2 type) family protein ... 27 7.6 At3g54630.1 68416.m06044 expressed protein weak similarity to re... 27 7.6 At3g48440.1 68416.m05288 zinc finger (CCCH-type) family protein ... 27 7.6 At3g04990.1 68416.m00542 hypothetical protein 27 7.6 At3g01290.1 68416.m00037 band 7 family protein similar to hypers... 27 7.6 At1g55545.1 68414.m06357 nucleoporin-related similar to nucleopo... 27 7.6 >At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5a) identical to GB:AAF22525 GI:6652886 from [Arabidopsis thaliana] Length = 424 Score = 132 bits (319), Expect = 1e-31 Identities = 61/112 (54%), Positives = 84/112 (75%), Gaps = 1/112 (0%) Frame = +3 Query: 114 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKV 293 ED +++ M T++I TRLLDNEI+I+K + R + E + +KIKEN EKIK+ Sbjct: 7 EDTSSFEEDQLASMSTEDITRATRLLDNEIRILKEDAQRTNLECDSYKEKIKENQEKIKL 66 Query: 294 NKTLPYLVSNVIELLDVDPQEE-EEDGAVVDLDSQRKGKCAVIKTSTRQTYF 446 NK LPYLV N++E+L+++P+++ EEDGA +DLDSQRKGKC V+KTSTRQT F Sbjct: 67 NKQLPYLVGNIVEILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIF 118 >At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, putative identical to SP:O04019 from [Arabidopsis thaliana] Length = 423 Score = 127 bits (307), Expect = 3e-30 Identities = 59/104 (56%), Positives = 82/104 (78%), Gaps = 1/104 (0%) Frame = +3 Query: 138 EEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLV 317 +++ M TD+I +RLL NEI+I+K E R + +L++ +KIKEN EKIK+NK LPYLV Sbjct: 14 DQLASMTTDDIGRASRLLANEIRILKEESQRTNLDLESVKEKIKENQEKIKLNKQLPYLV 73 Query: 318 SNVIELLDVDPQEE-EEDGAVVDLDSQRKGKCAVIKTSTRQTYF 446 N++E+L++ P+++ EEDGA +DLDSQRKGKC V+KTSTRQT F Sbjct: 74 GNIVEILEMSPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIF 117 >At3g05130.1 68416.m00557 expressed protein ; expression supported by MPSS Length = 634 Score = 35.5 bits (78), Expect = 0.016 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +3 Query: 195 NEIKIMKSEVMRISHELQAQNDKIKENTEKI-KVNKTLPYLVSNVIELLDVDPQEEEEDG 371 NE++I+K E + EL+ + DK+ E + K K L LV + + ++D E+E G Sbjct: 267 NEMEIVKIEQKGVIEELERKLDKLNETVRSLTKEEKVLRDLVIGLEK--NLDESMEKESG 324 Query: 372 AVVDLDSQRKGKCAVIKTS 428 +V++D+ GK IK S Sbjct: 325 MMVEIDA--LGKERTIKES 341 Score = 29.1 bits (62), Expect = 1.4 Identities = 19/71 (26%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = +3 Query: 99 DKSIWEDGE--EALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 272 DK++ E+ E L EVL+ ++++V++T ++KI + + ++L++Q++ +K Sbjct: 445 DKALDEEKRNGEDLKAEVLK--SEKMVAKTLEELEKVKIERKSLFSAKNDLESQSESLK- 501 Query: 273 NTEKIKVNKTL 305 +E +K+ K L Sbjct: 502 -SENVKLEKEL 511 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 33.9 bits (74), Expect = 0.050 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 1/115 (0%) Frame = +3 Query: 102 KSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL-QAQNDKIKENT 278 ++I +GEEAL E+ DE + T L + + S + +S L Q ++D + EN Sbjct: 775 ETICGEGEEALKEDKSPTVVDEALEDTALPEANLSDPSSPTVVVSKVLTQLKDDILAENV 834 Query: 279 EKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQTY 443 KI +P V+ L D EE+ V + I STR+ Y Sbjct: 835 SKIPEKVAVP---EEVLTQLKDDVLEEKVSEKVAIPEEVSILSRVPINISTRRAY 886 >At4g27500.1 68417.m03950 expressed protein non-consensus GA donor splice site at exon 6 Length = 612 Score = 31.9 bits (69), Expect = 0.20 Identities = 21/92 (22%), Positives = 45/92 (48%) Frame = +3 Query: 123 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKT 302 ++ ++ +R E + + + ++K+M + + + E QA + +I E +EK+K K Sbjct: 218 DKVIANAAMRAKIKESMGQKDDIQGQVKLMGAGLDGVKKERQAISARINELSEKLKATKD 277 Query: 303 LPYLVSNVIELLDVDPQEEEEDGAVVDLDSQR 398 ++ N EL V + ++ + DL QR Sbjct: 278 EITVLEN--ELKTVSEKRDKAYSNIHDLRRQR 307 >At3g53540.1 68416.m05912 expressed protein Length = 924 Score = 31.9 bits (69), Expect = 0.20 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 1/121 (0%) Frame = +3 Query: 6 WRARGWVQVLLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTR 185 W++ V +L N + ++HNI MATT + S++ED E+ S + T + R Sbjct: 775 WKSSYLVDLLANSS--FSDSDHNIVMATTPVEPSLFEDLEKKYSS----VKTSTRLERKL 828 Query: 186 LLDNEIKIMKSEVMRISH-ELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEE 362 L D + + + ++S ++ K+ + K+ +TL LV+ E EE+ Sbjct: 829 LFDQISREVLHMLKQLSDPHPWVKSTKVCPKWDANKIQETLRDLVTRKDEKPSKYDVEEK 888 Query: 363 E 365 E Sbjct: 889 E 889 >At5g27500.1 68418.m03287 hypothetical protein hypothetical proteins - Arabidopsis thaliana Length = 187 Score = 31.5 bits (68), Expect = 0.27 Identities = 18/69 (26%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +3 Query: 99 DKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENT 278 D S W++ ++ + + V ++++ ++ NEI +SEV I +EL A ++KE+ Sbjct: 47 DPSSWKNKKDWVEDAVYE-EVEDVLPNLGIMANEIVKARSEVNEIVNELSASIQELKEDA 105 Query: 279 --EKIKVNK 299 K+++ K Sbjct: 106 MCSKMEIRK 114 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 30.3 bits (65), Expect = 0.62 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 339 DVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQTYF 446 D + +EEEE+ VV++ ++KGK + +ST F Sbjct: 279 DEEEEEEEEEEVVVEVKKKKKGKAKIEHSSTAPPEF 314 >At5g46410.1 68418.m05712 NLI interacting factor (NIF) family protein contains Pfam profile PF03031: NLI interacting factor Length = 453 Score = 29.9 bits (64), Expect = 0.82 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +3 Query: 249 AQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQ 395 A D IK +T+KI ++ +L N +V+P + E D D Q Sbjct: 206 ANKDDIKSDTDKINLDNHDLFLAFNRTRSYNVEPDDRAESEVAEDFDPQ 254 >At4g08710.1 68417.m01439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 715 Score = 29.9 bits (64), Expect = 0.82 Identities = 19/67 (28%), Positives = 35/67 (52%) Frame = +3 Query: 195 NEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 374 N+I IM S++ R L+A D+ K EK+ ++ + ++SN + + D +EE G Sbjct: 577 NKIIIMISDLDRRVESLEAFKDEQKAKEEKVHIDNCV--ILSNTMITRNQDEMNQEEAGD 634 Query: 375 VVDLDSQ 395 + D + Sbjct: 635 SREKDQE 641 >At2g30500.1 68415.m03715 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 517 Score = 29.9 bits (64), Expect = 0.82 Identities = 21/103 (20%), Positives = 50/103 (48%), Gaps = 2/103 (1%) Frame = +3 Query: 114 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKV 293 EDG+EAL + + + ++ +LL + + + + H++ ++KE EK+++ Sbjct: 156 EDGDEALIRRMAELELELQETKQKLLLQQESVDGDNNVDLLHKITTYEGELKEANEKMRM 215 Query: 294 NK-TLPYLVSNVIELLDVDPQEE-EEDGAVVDLDSQRKGKCAV 416 ++ + L + + + D ++ + VDLD + + AV Sbjct: 216 HEDEIANLKNQLQSFMSFDTEDHLGAEQKSVDLDKEDTKEDAV 258 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 29.5 bits (63), Expect = 1.1 Identities = 26/102 (25%), Positives = 52/102 (50%), Gaps = 10/102 (9%) Frame = +3 Query: 24 VQVLLNL-KDYYEK-----TNHNITMATTLEDKSIWEDGEEALSEEVLRMPT---DEIVS 176 + LN+ K YEK + N ++A LE+ E G+ ++ V+ +E Sbjct: 1460 IHYTLNMTKRKYEKEKDELSKQNQSLAKQLEEAK-EEAGKRTTTDAVVEQSVKEREEKEK 1518 Query: 177 RTRLLDNEIKIMKSEVMRISHELQAQNDKI-KENTEKIKVNK 299 R ++LD + +K EV + + +L+ +++++ KE +E+ V K Sbjct: 1519 RIQILDKYVHQLKDEVRKKTEDLKKKDEELTKERSERKSVEK 1560 >At5g07220.1 68418.m00823 BAG domain-containing protein contains Pfam:PF02179 BAG domain Length = 303 Score = 29.1 bits (62), Expect = 1.4 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 7/87 (8%) Frame = +3 Query: 126 EALSEEVLRMPTDEIVSRTRLLDNEIKIM-KSEVMRISHELQAQND-KIKENTEKIKVNK 299 E L ++LR+ D I++ D ++K+M K +V R+ ++A + K+K + +K++VNK Sbjct: 176 EMLMNQLLRL--DAIIA-----DGDVKLMRKMQVQRVQKYVEALDLLKVKNSAKKVEVNK 228 Query: 300 TLPYLVSNVI-----ELLDVDPQEEEE 365 ++ + +LL +EEEE Sbjct: 229 SVRHKPQTQTRFEQRDLLSFVEEEEEE 255 >At5g58320.2 68418.m07301 kinase interacting protein-related low similarity to kinase interacting protein 1 [Petunia integrifolia] GI:13936326 Length = 558 Score = 28.7 bits (61), Expect = 1.9 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 114 EDGEEALSE-EVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 290 E+ E+ SE EVL + E L ++ ++SE+ R+ E++A++D+ E ++++ Sbjct: 447 EEEEKLKSEIEVLTLEKVEKGRCIETLSRKVSELESEISRLGSEIKARDDRTMEMEKEVE 506 >At5g41780.1 68418.m05087 myosin heavy chain-related weak similarity to M protein, serotype 5 precursor (SP:P02977) {Streptococcus pyogenes} and to Myosin heavy chain, non-muscle (SP:Q99323) (Zipper protein) (Myosin II) {Drosophila melanogaster} Length = 537 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +3 Query: 162 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 287 DEI +++ L+ ++K + + R+S E++ Q +KE + I Sbjct: 255 DEIEDKSKKLEYQVKEQEDIIQRLSMEIKDQKKLLKEQKDAI 296 >At3g24350.1 68416.m03057 syntaxin, putative (SYP32) similar to SP|Q9FFK1 Syntaxin 31 (AtSYP31) (AtSED5) {Arabidopsis thaliana}, syntaxin 5A GB:NP_003155 from [Homo sapiens] (J. Mol. Neurosci. (1997) 8 (2), 159-161) Length = 347 Score = 28.7 bits (61), Expect = 1.9 Identities = 19/86 (22%), Positives = 41/86 (47%) Frame = +3 Query: 33 LLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIM 212 L+N ++ ++ +H I +A + + + + A V PT EI T ++ EI + Sbjct: 52 LINKSEFNKRASH-IGLAINQTSQKLSKLAKLAKRTSVFDDPTQEIQELTVVIKQEISAL 110 Query: 213 KSEVMRISHELQAQNDKIKENTEKIK 290 S ++ + +QND+ + ++ K Sbjct: 111 NSALVDLQLFRSSQNDEGNNSRDRDK 136 >At1g29000.1 68414.m03546 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 287 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/73 (21%), Positives = 30/73 (41%) Frame = +3 Query: 222 VMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRK 401 V + +L+ K+K E +K++K + +EL+ P E ++ S + Sbjct: 42 VQNVDFDLEKNEIKVKGKIEVVKIHKQIEKWSKKKVELISPKPSEVKKTTTTTTTTSVVE 101 Query: 402 GKCAVIKTSTRQT 440 K IK +T Sbjct: 102 KKTTEIKKDVIRT 114 >At5g06850.1 68418.m00774 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 669 Score = 27.9 bits (59), Expect = 3.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 252 QNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEE 365 Q + ++ K+ V+ L YL NVIE DV+P + + Sbjct: 74 QGEGVQSVRSKVYVSPKLWYLRVNVIEAQDVEPSDRSQ 111 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 27.9 bits (59), Expect = 3.3 Identities = 13/72 (18%), Positives = 40/72 (55%) Frame = +3 Query: 141 EVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVS 320 EVL+ ++ S+ + + +++I+++++ + +L+ ++ E+++ ++S Sbjct: 1042 EVLQKEVNDFQSKENVTEKQVEILETQMEELQDKLRDTTMDNEQLQEQLRGKDMELLIIS 1101 Query: 321 NVIELLDVDPQE 356 N +ELL + +E Sbjct: 1102 NEMELLTSELEE 1113 >At2g05180.1 68415.m00545 cytochrome P450 family protein similar to Cytochrome P450 93A1 (SP:Q42798) {Glycine max} Length = 442 Score = 27.9 bits (59), Expect = 3.3 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 42 LKDYY--EKTNHNITMATTLEDKSIWEDGEEALSEEVLRMP 158 +K +Y EKT I + D WED +E E LR P Sbjct: 389 IKGFYIPEKTTLVINAYAVMRDPDSWEDPDEFKPERFLRAP 429 >At5g64330.1 68418.m08080 non-phototropic hypocotyl 3 (NPH3) identical to non-phototropic hypocotyl 3 [Arabidopsis thaliana] gi|6224712|gb|AAF05914, PMID:10542152 Length = 746 Score = 27.5 bits (58), Expect = 4.4 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +3 Query: 201 IKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVV 380 ++++ SE ++IS+ L N +KE+T + T ++ N L++ PQ +E A Sbjct: 596 VQVLFSEQVKISNALA--NTSLKESTTLGEAMGTYQPMIPNRKTLIEATPQSFQEGWAAA 653 Query: 381 DLD-SQRKGKCAVIKT 425 D + K + +KT Sbjct: 654 KKDINTLKFELETVKT 669 >At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein contains Pfam PF00096: Zinc finger, C2H2 type Length = 812 Score = 27.5 bits (58), Expect = 4.4 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 7/83 (8%) Frame = +3 Query: 213 KSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELL-----DVDPQEEEEDGAV 377 +S S ++Q+ K K + +KV L N ++ + +PQEEEE+ Sbjct: 662 RSAAQSSSQPKESQSSK-KNKGKAVKVVDPKETLADNFMDTVRRLQSSQNPQEEEEEAIS 720 Query: 378 VDLDSQR--KGKCAVIKTSTRQT 440 D ++ R KGK V+ T + T Sbjct: 721 KDKNTYRSDKGKSQVVGTDSSST 743 >At3g10180.1 68416.m01219 kinesin motor protein-related similar to centromere protein E GB:4502781 [Homo sapiens] Length = 1348 Score = 27.5 bits (58), Expect = 4.4 Identities = 29/123 (23%), Positives = 61/123 (49%), Gaps = 9/123 (7%) Frame = +3 Query: 96 EDKSIWEDGEEALS---EEVLRMPTD-EIVSRTRLLDNEIKIMKS---EVMRISHELQAQ 254 E+K+IW E+AL+ EE +R+ + +I S ++ + E K ++S E + ++ L+ Sbjct: 1010 EEKAIWSSKEKALTEAVEEKIRLYKNIQIESLSKEMSEEKKELESCRLECVTLADRLRCS 1069 Query: 255 NDKIKENTE-KIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVD-LDSQRKGKCAVIKTS 428 + K++ E ++ + + L + V Q +E + +D L S+ + C + T Sbjct: 1070 EENAKQDKESSLEKSLEIDRLGDELRSADAVSKQSQEVLKSDIDILKSEVQHACKMSDTF 1129 Query: 429 TRQ 437 R+ Sbjct: 1130 QRE 1132 >At1g30960.1 68414.m03791 GTP-binding protein (ERG) identical to GTP-binding protein ERG SP:O82653 from [Arabidopsis thaliana] Length = 437 Score = 27.5 bits (58), Expect = 4.4 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 102 KSIWEDGEEALSEEVLRMPTDEIVSRTRLLDN 197 K WE+ +SEEVL+ + E+V R RLLD+ Sbjct: 330 KKPWEEDAFTMSEEVLKNISLEVV-RERLLDH 360 >At4g14760.1 68417.m02271 M protein repeat-containing protein contains Pfam profile: PF02370 M protein repeat Length = 1676 Score = 27.1 bits (57), Expect = 5.8 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +3 Query: 207 IMKSEVMRISHELQAQNDKIKENTEKIK-VNKTLPYLVSNVIEL 335 I++++V +S + ND++ T KIK + +T+ +L S V EL Sbjct: 1252 ILENKVNELSGVCENLNDEVVTKTTKIKQMKETVGFLESQVTEL 1295 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 27.1 bits (57), Expect = 5.8 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 4/81 (4%) Frame = +3 Query: 171 VSRTRLLDNEIKIMKSEVMRISHELQAQNDK---IKENTEKIKVNKT-LPYLVSNVIELL 338 +SRTR +E R+ +L ND ++E E +V + + + + E + Sbjct: 1 MSRTRTAASEAHDSMESEERV--DLDGDNDPEEILEEEVEYEEVEEEEIEEIEEEIEEEV 58 Query: 339 DVDPQEEEEDGAVVDLDSQRK 401 +V+ +EEEED + + ++K Sbjct: 59 EVEEEEEEEDAVATEEEEEKK 79 >At3g04830.2 68416.m00524 expressed protein Length = 299 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 84 ATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRL 188 A LE K +WE+ E+A + + P D+++ + ++ Sbjct: 101 ALLLEAKGMWEEAEKAYTSLLEDNPLDQVIHKRKV 135 >At3g04830.1 68416.m00523 expressed protein Length = 303 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 84 ATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRL 188 A LE K +WE+ E+A + + P D+++ + ++ Sbjct: 105 ALLLEAKGMWEEAEKAYTSLLEDNPLDQVIHKRKV 139 >At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing protein contains similarity to 67kD chloroplastic RNA-binding protein, P67.1 [Raphanus sativus] GI:9755886; contains Pfam profile PF01535: PPR repeat Length = 711 Score = 26.6 bits (56), Expect = 7.6 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 4/94 (4%) Frame = +3 Query: 132 LSEEVLRMPTDEIVSRTRLL-DNEIKIMKS--EVMRISHELQAQNDKIKE-NTEKIKVNK 299 LS LR +I+S+ + + N + +S + R + N +IK+ +K+N Sbjct: 72 LSATTLRQEQTQILSKPKSVWVNPTRPKRSVLSLQRQKRSAYSYNPQIKDLRAFALKLNS 131 Query: 300 TLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRK 401 ++ S + LLD P D A++ L+S R+ Sbjct: 132 SIFTEKSEFLSLLDEIPHPPNRDNALLVLNSLRE 165 >At4g35610.1 68417.m05058 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 271 Score = 26.6 bits (56), Expect = 7.6 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +3 Query: 57 EKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSR 179 EKT ++T E W D E + E VL +P I SR Sbjct: 7 EKTKVDVTEEEKEESDEQWSDEETNMREIVLGLPALNISSR 47 >At3g54630.1 68416.m06044 expressed protein weak similarity to retinoblastoma-associated protein HEC [Homo sapiens] GI:2501873 Length = 568 Score = 26.6 bits (56), Expect = 7.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 363 EDGAVVDLDSQRKGKCAVIKTSTRQT 440 ED V DLDSQ GK KTS +T Sbjct: 191 EDDKVNDLDSQFLGKLEAEKTSVAET 216 >At3g48440.1 68416.m05288 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 448 Score = 26.6 bits (56), Expect = 7.6 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 255 NDKIKENTEKI-KVNKTLPYLVSNVIELLDVDPQEEEED 368 N+ KE +EK+ V+++ L SN + ++ + +EEEED Sbjct: 50 NEVTKEQSEKMMSVSESNGGLDSNAVVTINQEEEEEEED 88 >At3g04990.1 68416.m00542 hypothetical protein Length = 227 Score = 26.6 bits (56), Expect = 7.6 Identities = 18/84 (21%), Positives = 41/84 (48%), Gaps = 3/84 (3%) Frame = +3 Query: 24 VQVLLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTR---LLD 194 VQV+ LK Y + H +ED++ + E +++ + ++ ++ ++R L D Sbjct: 110 VQVMAELKRRYSEARHVQKRKREMEDETATKKKELSMTVDQIQESGKQLEKKSREVELKD 169 Query: 195 NEIKIMKSEVMRISHELQAQNDKI 266 EI+ E+ + +++A K+ Sbjct: 170 KEIEEKGKELDLVKSQVKAWERKL 193 >At3g01290.1 68416.m00037 band 7 family protein similar to hypersensitive-induced response protein [Zea mays] GI:7716470; contains Pfam profile PF01145: SPFH domain / Band 7 family Length = 285 Score = 26.6 bits (56), Expect = 7.6 Identities = 22/77 (28%), Positives = 36/77 (46%) Frame = +3 Query: 36 LNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMK 215 LNL D +E+ N DK++ G E L ++ + D+ V R NEI Sbjct: 112 LNLDDVFEQKNEIAKSVEEELDKAMTAYGYEILQTLIIDIEPDQQVKRAM---NEIN--A 166 Query: 216 SEVMRISHELQAQNDKI 266 + MR++ +A+ +KI Sbjct: 167 AARMRVAASEKAEAEKI 183 >At1g55545.1 68414.m06357 nucleoporin-related similar to nucleoporin CAN [Xenopus laevis] gi|5764080|emb|CAB53357 Length = 824 Score = 26.6 bits (56), Expect = 7.6 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +3 Query: 120 GEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK 299 G A S+ L +D + T L+++++ SE + + QND+ NTEK + Sbjct: 427 GRPASSDTDLASSSDIEDAYTPLIEDDLSKQSSEKHQ-QLNIAVQNDQKHLNTEKFSTEQ 485 Query: 300 TLP 308 LP Sbjct: 486 RLP 488 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,927,680 Number of Sequences: 28952 Number of extensions: 130389 Number of successful extensions: 601 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -