BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0903 (359 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0010 + 9574265-9574524,9574629-9574956,9576663-9576788,957... 29 0.83 02_05_0076 + 25637752-25639062,25639221-25639297,25640962-256410... 27 4.4 >10_06_0010 + 9574265-9574524,9574629-9574956,9576663-9576788, 9576948-9577067,9577350-9577562,9577653-9577764, 9578033-9578217,9578310-9578660,9578826-9579383 Length = 750 Score = 29.5 bits (63), Expect = 0.83 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 188 NGGYEVPWSLKMRCCLFL 135 +G Y +PWS+KM+ CL + Sbjct: 723 SGRYGIPWSIKMKACLLV 740 >02_05_0076 + 25637752-25639062,25639221-25639297,25640962-25641095, 25641178-25641242,25641431-25641482,25641912-25641994, 25642128-25642221,25642332-25642861 Length = 781 Score = 27.1 bits (57), Expect = 4.4 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 116 LYRFSYSERTRCQQFKRLNDYFGRKASRDKK 24 L FS+S+ C QF +ND + S DKK Sbjct: 499 LKTFSHSDYVTCIQFNPVNDKYFISGSLDKK 529 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,559,366 Number of Sequences: 37544 Number of extensions: 177406 Number of successful extensions: 440 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 554421256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -