BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0902 (591 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18244| Best HMM Match : Fukutin-related (HMM E-Value=3.7) 33 0.23 SB_29353| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_48498| Best HMM Match : DUF369 (HMM E-Value=2.4) 27 8.7 >SB_18244| Best HMM Match : Fukutin-related (HMM E-Value=3.7) Length = 540 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -3 Query: 586 HLYITRYTGILLNRAFL*RGTNIPRYREDYCMYVIY 479 H+Y+TRY LL R + RYR+DY +YV+Y Sbjct: 271 HVYMTRYHLNLLFRTAWSLSSTRCRYRDDYYLYVMY 306 >SB_29353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = +3 Query: 96 LASNLKASSSPILLF*TTNLHKTTQSKGAFIIKSNQIYFVIA 221 L++ +K S I++F K ++ G F++++N ++FV++ Sbjct: 120 LSARIKVESQSIVVF-RIKYRKIAKAFGTFVLRANSLWFVLS 160 >SB_48498| Best HMM Match : DUF369 (HMM E-Value=2.4) Length = 734 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 Query: 500 LLYVCYIFKYHFRH 459 LLYV Y++ +HFRH Sbjct: 710 LLYVLYLWNFHFRH 723 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,879,718 Number of Sequences: 59808 Number of extensions: 262630 Number of successful extensions: 425 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -