BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0901 (649 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 27 0.51 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 25 1.6 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 6.3 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 6.3 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 6.3 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 27.1 bits (57), Expect = 0.51 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 281 GVCLRTMQHPDSQVNSLEISPTSMVAAAGFQHIRLY 388 GVCLR +P ++ ISP A F HI L+ Sbjct: 69 GVCLRLQSNPQNKEQFFGISPERGFADFVFAHIILH 104 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 25.4 bits (53), Expect = 1.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 242 LLLLKPPAILQEKQWYHQPFYETY 171 +LL+ P + E W H FY+ Y Sbjct: 10 VLLIVPSLLADEHWWQHANFYQIY 33 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +3 Query: 507 QPGYGIPG 530 QPGYGIPG Sbjct: 499 QPGYGIPG 506 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 527 RAAPRTRCQKIFQVQAPVNAVMLH 598 RA + RC+K+FQV + V + H Sbjct: 282 RAFNKERCKKLFQVPSGVGVGLGH 305 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 389 DLSSANPDPVTTFEDISKNVSR 454 D+ N DP+ T EDI K + R Sbjct: 394 DVLITNIDPLATEEDIKKAIER 415 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 772,733 Number of Sequences: 2352 Number of extensions: 16742 Number of successful extensions: 44 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -