BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0898 (479 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 24 0.63 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 23 1.5 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 23 1.5 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 1.9 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 2.6 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 22 2.6 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 3.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 5.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.8 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 24.2 bits (50), Expect = 0.63 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 214 LQKHSRQWFDVVQIYGRGQSNERYDFAFVFWM*GHERE 101 L+ +++ W + Q RG + R DF +W +R+ Sbjct: 188 LKGNAKHWTGIFQKKWRGYEDFRRDFLRTYWSAKRQRD 225 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 354 TRFIRDEHTSVFGFLKLHKVPKNFLNSGSN 265 T+F TS F FL LH + ++ N Sbjct: 242 TKFTEQSVTSTFDFLSLHPAETSMNDANRN 271 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 354 TRFIRDEHTSVFGFLKLHKVPKNFLNSGSN 265 T+F TS F FL LH + ++ N Sbjct: 242 TKFTEQSVTSTFDFLSLHPAETSMNDANRN 271 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 1.9 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +1 Query: 142 RIFHCSGPCRISGQRQTTGDYV 207 + FHC P + + GDY+ Sbjct: 421 QFFHCYCPIKFGRKADPNGDYI 442 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +1 Query: 61 DNIHRIFYGNNHLLHVHVLTSRIQKQNRIFHC 156 DN+ I Y ++ VH+ I + + F C Sbjct: 235 DNVDTIMYEKTNVTFVHLAVLNILRVGKNFVC 266 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 354 TRFIRDEHTSVFGFLKLH 301 T+F TS F FL LH Sbjct: 242 TKFTEQSVTSTFDFLSLH 259 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 3.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 229 GYVHILQKHSR 197 GY H+LQ H R Sbjct: 145 GYKHVLQNHER 155 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 78 ILWEQPPSSRSCPHIQNTKAKSYLSLLWPLPYIWTTSNHW 197 + +E PP I + A ++ LLW L W T + W Sbjct: 445 LFFESPPVVFLNDFISHQHA--WIWLLWLLSQTWITLHIW 482 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 78 ILWEQPPSSRSCPHIQNTKAKSYLSLLWPLPYIWTTSNHW 197 + +E PP I + A ++ LLW L W T + W Sbjct: 445 LFFESPPVVFLNDFISHQHA--WIWLLWLLSQTWITLHIW 482 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 78 ILWEQPPSSRSCPHIQNTKAKSYLSLLWPLPYIWTTSNHW 197 + +E PP I + A ++ LLW L W T + W Sbjct: 445 LFFESPPVVFLNDFISHQHA--WIWLLWLLSQTWITLHIW 482 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 78 ILWEQPPSSRSCPHIQNTKAKSYLSLLWPLPYIWTTSNHW 197 + +E PP I + A ++ LLW L W T + W Sbjct: 445 LFFESPPVVFLNDFISHQHA--WIWLLWLLSQTWITLHIW 482 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 5.9 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 127 IQKQNRIFHCSGPCRISGQRQTTGDYVFEEY 219 I + + C G R GQ + D FE+Y Sbjct: 57 IPAKRAAYDCEGVIRHHGQWNYSPDNHFEQY 87 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 306 LHKVPKNFLNSGSNVADIN 250 L VP NF G +V +IN Sbjct: 693 LPPVPPNFPTCGDHVPEIN 711 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,024 Number of Sequences: 336 Number of extensions: 2703 Number of successful extensions: 25 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -