BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0898 (479 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 24 0.97 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 5.2 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 6.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.1 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.8 bits (49), Expect = 0.97 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +1 Query: 142 RIFHCSGPCRISGQRQTTGDYV 207 + FHC P R + GDY+ Sbjct: 425 QFFHCYCPVRFGRKADPNGDYI 446 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 5.2 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 192 GLTLSRYTAGARAMKDTILLLYSGCEDMNVKKVV 91 GL L +KD++++L S ++MN K + Sbjct: 278 GLKLINAENETAHIKDSLIVLTSALQEMNKSKSI 311 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 376 DRSGRKVYVGGKNGAGLLETDRALWENSFDR 468 DR+ VY+ + G GL+ + ++SF R Sbjct: 200 DRTNTMVYIADEKGEGLIMYQNS--DDSFHR 228 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 90 VPIEYPMYIIFWWPVTLRTLSIMAGASYLP 1 VP++Y Y WW L L ++ +P Sbjct: 515 VPVKYLTYEYPWWSHVLGWLCGLSSMLCIP 544 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 90 VPIEYPMYIIFWWPVTLRTLSIMAGASYLP 1 VP++Y Y WW L L ++ +P Sbjct: 568 VPVKYLTYEYPWWSHVLGWLCGLSSMLCIP 597 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,878 Number of Sequences: 438 Number of extensions: 3487 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -