BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0897 (508 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125956-2|AAD14724.2| 178|Caenorhabditis elegans Hypothetical ... 27 5.9 AF125956-1|AAV28359.1| 472|Caenorhabditis elegans Hypothetical ... 27 5.9 >AF125956-2|AAD14724.2| 178|Caenorhabditis elegans Hypothetical protein DC2.3a protein. Length = 178 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 300 SLSGHPCCDISHTIRPSYLHHIALHGNVRI 211 S SG CD H + + I+++GN+R+ Sbjct: 134 SASGKHMCDFPHRVPVESIRTISINGNIRV 163 >AF125956-1|AAV28359.1| 472|Caenorhabditis elegans Hypothetical protein DC2.3b protein. Length = 472 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 300 SLSGHPCCDISHTIRPSYLHHIALHGNVRI 211 S SG CD H + + I+++GN+R+ Sbjct: 266 SASGKHMCDFPHRVPVESIRTISINGNIRV 295 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,334,701 Number of Sequences: 27780 Number of extensions: 178908 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -