BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0896 (568 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 1e-23 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 78 4e-15 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 76 2e-14 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 69 4e-12 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 3e-11 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 62 4e-10 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 59 3e-09 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 58 5e-09 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 51 8e-07 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 50 1e-06 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 49 2e-06 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 49 2e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 3e-06 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 9e-06 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 46 3e-05 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 44 7e-05 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 44 9e-05 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 40 0.001 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 40 0.002 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 38 0.008 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 34 0.070 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) 33 0.22 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 31 0.50 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 1.5 SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) 29 2.0 SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) 29 2.6 SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 106 bits (255), Expect = 1e-23 Identities = 44/112 (39%), Positives = 70/112 (62%) Frame = +2 Query: 233 PDWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPD 412 P+ + +PFNKNFY+ HP + K+S E+++ R + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 413 YVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAIVH 568 + ++ + Y +PT IQ Q PIA+SG++++G+A+TGSGKT A++ PA+VH Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVH 578 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 78.2 bits (184), Expect = 4e-15 Identities = 32/79 (40%), Positives = 53/79 (67%) Frame = +2 Query: 329 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 508 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 509 GVAQTGSGKTLAYILPAIV 565 GVA+TGSGKT A+ +P +V Sbjct: 143 GVAETGSGKTAAFAIPLLV 161 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 75.8 bits (178), Expect = 2e-14 Identities = 36/98 (36%), Positives = 57/98 (58%) Frame = +2 Query: 263 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 442 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 443 YKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILP 556 ++ PTPIQ Q MSG++++G+A+TGSGKTLAY LP Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLP 129 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 68.5 bits (160), Expect = 4e-12 Identities = 31/88 (35%), Positives = 51/88 (57%) Frame = +2 Query: 278 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 457 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 458 PIQAQGWPIAMSGKNLVGVAQTGSGKTL 541 PIQ Q P+ +SG++++ A TGSGK L Sbjct: 221 PIQMQVLPVLLSGRDVMVCASTGSGKLL 248 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 66.1 bits (154), Expect = 2e-11 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 1/103 (0%) Frame = +2 Query: 218 QNMRRPDWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFE 394 + ++ D +V QPF K+FY P + K +P E +E+R + E + V G P++ + Sbjct: 49 EELQPVDHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWA 108 Query: 395 EANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQT 523 + + +K Y++PTPIQAQ P+ MSG++++ + T Sbjct: 109 QTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIAIVMT 151 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 66.1 bits (154), Expect = 2e-11 Identities = 32/73 (43%), Positives = 45/73 (61%) Frame = +2 Query: 344 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQT 523 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++ AQT Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQT 757 Query: 524 GSGKTLAYILPAI 562 GSGKT A++LP + Sbjct: 758 GSGKTAAFLLPVM 770 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 65.3 bits (152), Expect = 3e-11 Identities = 30/70 (42%), Positives = 41/70 (58%) Frame = +2 Query: 353 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSG 532 VSG I F E F + + + GY+ PTP+Q PI M+G++L+ AQTGSG Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSG 528 Query: 533 KTLAYILPAI 562 KT AY+LP + Sbjct: 529 KTAAYMLPVL 538 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 61.7 bits (143), Expect = 4e-10 Identities = 32/84 (38%), Positives = 46/84 (54%) Frame = +2 Query: 305 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 484 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQFILP 116 Query: 485 AMSGKNLVGVAQTGSGKTLAYILP 556 + N + Q G G + + P Sbjct: 117 GIVHINHQPLLQPGDGPIVLVLCP 140 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 58.8 bits (136), Expect = 3e-09 Identities = 25/61 (40%), Positives = 40/61 (65%) Frame = +2 Query: 380 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPA 559 ++ F + G+ G+ PT IQ QG P+A+SG++++G A+TGSGKTLA+++P Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPI 108 Query: 560 I 562 I Sbjct: 109 I 109 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 58.0 bits (134), Expect = 5e-09 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = +2 Query: 344 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQT 523 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++ AQT Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQT 180 Query: 524 GSGKT 538 GSGKT Sbjct: 181 GSGKT 185 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 55.2 bits (127), Expect = 4e-08 Identities = 24/61 (39%), Positives = 37/61 (60%) Frame = +2 Query: 380 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPA 559 I FE+ + + + V GYK+PTP+Q PI ++L+ AQTGSGKT A+++P Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPI 933 Query: 560 I 562 + Sbjct: 934 L 934 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 50.8 bits (116), Expect = 8e-07 Identities = 21/47 (44%), Positives = 32/47 (68%) Frame = +2 Query: 422 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 + V +G+ PTPIQA P+A+ GK++ A TG+GKT A++LP + Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPIL 69 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/75 (36%), Positives = 39/75 (52%) Frame = +2 Query: 344 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQT 523 EV + G P + F +Y + +G PT +Q WP + G+++ GVA Sbjct: 178 EVLIQGESAPRPFLTMNNSTFYEYGPR----LGVTVPTSLQKHMWPSLLRGRDVAGVAIE 233 Query: 524 GSGKTLAYILPAIVH 568 GSGK LAY+LP I+H Sbjct: 234 GSGKRLAYLLP-IIH 247 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 50.0 bits (114), Expect = 1e-06 Identities = 21/47 (44%), Positives = 33/47 (70%) Frame = +2 Query: 422 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 QG+K MG+ T IQ + + G++L+G A+TGSGKTLA+++P + Sbjct: 585 QGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVV 631 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/58 (32%), Positives = 38/58 (65%) Frame = +2 Query: 389 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 FE+ + G+ G+ +P+PIQ + P+A++G++++ A+ G+GKT AY++P + Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLL 106 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/58 (32%), Positives = 38/58 (65%) Frame = +2 Query: 389 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 FE+ + G+ G+ +P+PIQ + P+A++G++++ A+ G+GKT AY++P + Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLL 106 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 3e-06 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = +2 Query: 317 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 484 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 485 AMSGKNLVG 511 G G Sbjct: 197 MAHGPKKSG 205 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 47.2 bits (107), Expect = 9e-06 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +2 Query: 407 PDYVQQGVKTMGYKEPTPIQAQGWPIAMS-GKNLVGVAQTGSGKTLAYILPAIVH 568 PD + + + G+ +PTPIQ+ P A+ ++++G A+TGSGKTLA+ +P I H Sbjct: 139 PD-ILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPIIQH 192 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/42 (47%), Positives = 28/42 (66%) Frame = +2 Query: 437 MGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 MG K+PT IQ P + G++ +G A+TGSGKT A+ LP + Sbjct: 25 MGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPIL 66 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/52 (38%), Positives = 35/52 (67%) Frame = +2 Query: 407 PDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 P V++ +K MG +P PIQ + P S K+L+ ++TG+GK+L ++LP++ Sbjct: 169 PKLVEK-LKKMGITKPVPIQEKALPSVFSHKSLLIKSETGTGKSLVFLLPSV 219 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 44.0 bits (99), Expect = 9e-05 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 5/76 (6%) Frame = +2 Query: 341 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK--NL 505 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ N+ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNM 145 Query: 506 VGVAQTGSGKTLAYIL 553 + +Q+G+GKT A++L Sbjct: 146 IAQSQSGTGKTAAFVL 161 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 39.9 bits (89), Expect = 0.001 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 2/97 (2%) Frame = +2 Query: 284 PHPTVLK-RSPYEVEEYRNNHEVTV-SGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 457 P TV K +E N T S + + F D V + + + +PT Sbjct: 343 PEATVSKGEKEVTIEAVGQNPAFTPDSDMAFRQRVYSFAGLGLRDDVLKALDALNIHQPT 402 Query: 458 PIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAIVH 568 IQ P + +++ AQTGSGKTLAY+ P +VH Sbjct: 403 VIQMVTIPKIIHRHHVICAAQTGSGKTLAYLAP-LVH 438 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/47 (31%), Positives = 31/47 (65%) Frame = +2 Query: 422 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 +G+ G+++P+PIQ + P+ G +L+ A++G+GKT + + A+ Sbjct: 26 RGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIAL 72 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 38.3 bits (85), Expect = 0.004 Identities = 14/26 (53%), Positives = 22/26 (84%) Frame = +2 Query: 479 PIAMSGKNLVGVAQTGSGKTLAYILP 556 P+ M GK++V +A+TGSGKT A+++P Sbjct: 313 PLVMDGKDVVAMARTGSGKTAAFLIP 338 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 37.5 bits (83), Expect = 0.008 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = +2 Query: 458 PIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 PIQA + G++++G A+TG+GKTL++ LP + Sbjct: 98 PIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLV 132 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 34.3 bits (75), Expect = 0.070 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 1/101 (0%) Frame = +2 Query: 269 KNFYDPHPTVLKRSPYEVEEYRNNHEV-TVSGVEVHNPIQYFEEANFPDYVQQGVKTMGY 445 K D + LK E +E+ N + TV+ + P+ E P V + + +G+ Sbjct: 467 KELPDENDENLKEFAPEDDEFLKNLSLDTVAQMAAGIPV----ETETPPEVYKALGQLGF 522 Query: 446 KEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAIVH 568 Q Q +SG + + V TG+GK+L Y LPA ++ Sbjct: 523 SSFRAGQEQAVMRILSGMSSLVVLSTGAGKSLCYQLPAYMY 563 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 33.1 bits (72), Expect = 0.16 Identities = 12/44 (27%), Positives = 28/44 (63%) Frame = +2 Query: 431 KTMGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAI 562 +T G+++P+ IQ + + G++++ AQ+G+GKT + + + Sbjct: 13 ETEGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVL 56 >SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) Length = 304 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +2 Query: 440 GYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAIV 565 GY + P+Q Q ++ K+ + + TG+GKT+ Y +PA++ Sbjct: 136 GYIDFRPMQRQAIDTLLAEKDSLILLPTGAGKTICYAIPALL 177 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 31.5 bits (68), Expect = 0.50 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +2 Query: 497 KNLVGVAQTGSGKTLAYILPAI 562 K+++G+A+TGSGKT A+ LP + Sbjct: 2 KDVIGLAETGSGKTGAFALPIL 23 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 0.87 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 365 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 478 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 275 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 415 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) Length = 493 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = -3 Query: 167 YCHRCQIEKNYRRICCLL----QIWNHRFHGYYSSYQT*LFF 54 +CHR Q NY C ++ Q+W+H + SS ++ +F+ Sbjct: 178 FCHRQQYRHNYYNSCLVITFFRQMWDHLWANVGSSVESSVFY 219 >SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) Length = 651 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 488 MSGKNLVGVAQTGSGKTLAYILPAIV 565 MSG + + + TG GK+L + LPA+V Sbjct: 102 MSGVDCILIMPTGGGKSLCFQLPAVV 127 >SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1281 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 461 IQAQGWPIAMSGKNLVGVAQ-TGSGKTLAYILPAIV 565 +Q + G+ V V+ TGSGK+L Y LPA+V Sbjct: 22 LQQRACETVSKGRQDVFVSMPTGSGKSLCYQLPAVV 57 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,151,326 Number of Sequences: 59808 Number of extensions: 327271 Number of successful extensions: 974 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 971 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -