BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0894 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 6.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 6.0 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 6.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -2 Query: 417 LNLRTLSTFGHHRNRLCMVKLTGYQFFPIC 328 L + + FGHH NRL T + F C Sbjct: 310 LGVGFMRIFGHHLNRLGREISTYFTFTRPC 339 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 289 FSVAPDLSDAMCATNWEKLVPS*FYHTEAI 378 FS +P+LS+ + + +PS Y +A+ Sbjct: 242 FSTSPELSNKQRFEYFTRTIPSDHYQVKAM 271 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 444 LLDEESIAKAVRYSNVVINLV 506 L+ + +AK Y N+V+ L+ Sbjct: 317 LVKDSGVAKDAAYDNIVLKLL 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,399 Number of Sequences: 438 Number of extensions: 2651 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -