BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0889 (560 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 71 4e-13 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 69 2e-12 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 68 5e-12 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 68 5e-12 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 66 1e-11 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 64 6e-11 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 64 8e-11 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 64 8e-11 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 62 2e-10 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 62 3e-10 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 61 4e-10 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 61 6e-10 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 61 6e-10 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 58 4e-09 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 58 4e-09 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 54 5e-08 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 53 1e-07 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 51 5e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 1e-06 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 49 2e-06 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 47 1e-05 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 46 1e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 46 2e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 46 2e-05 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 45 4e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 4e-05 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 44 9e-05 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 44 9e-05 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 43 1e-04 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 42 2e-04 At5g61340.1 68418.m07697 expressed protein 42 4e-04 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 42 4e-04 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 41 7e-04 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 41 7e-04 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 40 0.001 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 40 0.001 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 40 0.002 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 39 0.003 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 38 0.005 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 38 0.006 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 38 0.006 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 38 0.006 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 38 0.006 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 37 0.008 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 37 0.008 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 37 0.008 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 37 0.008 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 37 0.011 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 37 0.011 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 36 0.014 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 36 0.014 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 36 0.019 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 34 0.057 At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase f... 34 0.075 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 33 0.099 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 33 0.099 At3g03860.1 68416.m00398 expressed protein 32 0.23 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 32 0.30 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 2.1 At4g31240.2 68417.m04435 expressed protein 28 4.9 At4g31240.1 68417.m04434 expressed protein 28 4.9 At2g29040.1 68415.m03530 exostosin family protein contains Pfam ... 28 4.9 At1g78740.1 68414.m09177 hypothetical protein 27 6.5 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 27 6.5 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 71.3 bits (167), Expect = 4e-13 Identities = 32/91 (35%), Positives = 50/91 (54%) Frame = +2 Query: 104 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 283 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDEL 71 Query: 284 XXXASEYNINSMPTFVFVKNGKKLDEFSGAN 376 A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 72 QSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 68.9 bits (161), Expect = 2e-12 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 2/96 (2%) Frame = +2 Query: 101 IHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 274 + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+AA+ Sbjct: 40 VEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKIDVD 99 Query: 275 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 382 E+N++++P VF+K G+++D G VD Sbjct: 100 VLMSVW-MEFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 67.7 bits (158), Expect = 5e-12 Identities = 31/94 (32%), Positives = 53/94 (56%) Frame = +2 Query: 95 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 274 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDID 332 Query: 275 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 376 AS +NI+S+PTF F+++GK++D+ GA+ Sbjct: 333 KANDVAAS-WNISSVPTFCFIRDGKEVDKVVGAD 365 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 67.7 bits (158), Expect = 5e-12 Identities = 29/79 (36%), Positives = 45/79 (56%) Frame = +2 Query: 137 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINS 316 L + DK V++DF ATWCGPC+++ P L+E++ + A++Y I + Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEA 130 Query: 317 MPTFVFVKNGKKLDEFSGA 373 +PTF+ K+GK D F GA Sbjct: 131 LPTFILFKDGKLWDRFEGA 149 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 66.5 bits (155), Expect = 1e-11 Identities = 30/77 (38%), Positives = 44/77 (57%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 331 +KL+V+DF A+WCGPC+MI P + + A+ A E+N+ +MPTFV Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAM-ADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFV 105 Query: 332 FVKNGKKLDEFSGANVD 382 VK GK+++ GA D Sbjct: 106 LVKRGKEIERIIGAKKD 122 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 64.1 bits (149), Expect = 6e-11 Identities = 33/92 (35%), Positives = 50/92 (54%) Frame = +2 Query: 101 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 280 I K+S D K A+ K+VV +F ATWCGPCK++ P E+ +E Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDE 86 Query: 281 XXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 376 +S ++I + PTF F+KNG+++ + GAN Sbjct: 87 LSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 63.7 bits (148), Expect = 8e-11 Identities = 32/96 (33%), Positives = 52/96 (54%) Frame = +2 Query: 95 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 274 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDT 67 Query: 275 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 382 AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 68 DELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 63.7 bits (148), Expect = 8e-11 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 331 DK V++D+ ATWCGPC+ + P L+E++ + A++Y I ++PTF+ Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFI 140 Query: 332 FVKNGKKLDEFSGA 373 K+G+ D F GA Sbjct: 141 LFKDGEPCDRFEGA 154 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 62.5 bits (145), Expect = 2e-10 Identities = 30/90 (33%), Positives = 43/90 (47%) Frame = +2 Query: 113 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 292 D D + AGDK+VV+D WCGPCK+I PK E++ + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPL 143 Query: 293 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 382 A E I +PTF +K+ K + E +GA + Sbjct: 144 AKELGIRVVPTFKILKDNKVVKEVTGAKYE 173 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 61.7 bits (143), Expect = 3e-10 Identities = 30/80 (37%), Positives = 43/80 (53%) Frame = +2 Query: 143 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 322 + +KL+VIDF A WCGPCK + P++ EIA++ A Y ++P Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASK-YSEAVFARVDVDRLMDVAGTYRAITLP 98 Query: 323 TFVFVKNGKKLDEFSGANVD 382 FVFVK G+++D GA D Sbjct: 99 AFVFVKRGEEIDRVVGAKPD 118 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 61.3 bits (142), Expect = 4e-10 Identities = 31/85 (36%), Positives = 42/85 (49%) Frame = +2 Query: 128 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 307 K + A KL+VIDF A+WC PC+ I P E+A + A E+ Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKF-TNVVFFKIDVDELQAVAQEFK 77 Query: 308 INSMPTFVFVKNGKKLDEFSGANVD 382 + +MPTFVF+K G +D GA D Sbjct: 78 VEAMPTFVFMKEGNIIDRVVGAAKD 102 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 60.9 bits (141), Expect = 6e-10 Identities = 30/90 (33%), Positives = 49/90 (54%) Frame = +2 Query: 104 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 283 ++ DS+ +T++ E+ D V+++F A WCGPC+MI P +D++A + Sbjct: 90 NLSDSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147 Query: 284 XXXASEYNINSMPTFVFVKNGKKLDEFSGA 373 A+ Y I S+PT + K G+K D GA Sbjct: 148 PNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 60.9 bits (141), Expect = 6e-10 Identities = 30/90 (33%), Positives = 42/90 (46%) Frame = +2 Query: 113 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 292 D D + AG+KLVV+D WCGPCK+I PK ++ + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPL 133 Query: 293 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 382 A E I +PTF +K+ K + E +GA D Sbjct: 134 AKELGIRVVPTFKILKDNKVVKEVTGAKYD 163 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 58.0 bits (134), Expect = 4e-09 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +2 Query: 128 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 307 K + A KL+VIDF ATWC PC+ I P ++ A+ A E+ Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADL-AKKHLDVVFFKVDVDELNTVAEEFK 77 Query: 308 INSMPTFVFVKNGKKLDEFSGA 373 + +MPTF+F+K G+ + GA Sbjct: 78 VQAMPTFIFMKEGEIKETVVGA 99 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 58.0 bits (134), Expect = 4e-09 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = +2 Query: 116 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA 295 +D L D+ V +DF A WCGPCKMI P ++E+A + Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATP 139 Query: 296 SEYNINSMPTFVFVKNGKKLDEFSGA 373 +Y + S+PT + NG+K D GA Sbjct: 140 GQYGVRSIPTIMIFVNGEKKDTIIGA 165 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/71 (33%), Positives = 34/71 (47%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 340 VV+DF A WCGPCKMI P ++++A +Y + S+PT + Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160 Query: 341 NGKKLDEFSGA 373 G+K D GA Sbjct: 161 GGEKKDTIIGA 171 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 53.2 bits (122), Expect = 1e-07 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 340 V+++F +WCGPC+M+ +DEIA + A EY I ++P + K Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 341 NGKKLDEFSG 370 NG+K + G Sbjct: 147 NGEKRESIMG 156 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 51.2 bits (117), Expect = 5e-07 Identities = 19/65 (29%), Positives = 36/65 (55%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 340 V+++F+ATWCGPCK+I P ++ ++ E +E+ + +P F+ K Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 341 NGKKL 355 +GK++ Sbjct: 150 DGKEV 154 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +2 Query: 89 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 238 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 48.8 bits (111), Expect = 2e-06 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 3/101 (2%) Frame = +2 Query: 83 YLPKMSIH-IKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 253 Y K +H + + + ++ EA K++V++F A+WC P K I P E+A+ Sbjct: 36 YFIKGKVHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTILPIYQELAS-TYTSM 94 Query: 254 XXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 376 + E+N+++ PT VF+K+G+++D+ G + Sbjct: 95 IFVTIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGD 135 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 46.8 bits (106), Expect = 1e-05 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 3/94 (3%) Frame = +2 Query: 107 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 280 +K ++ +++A D + V F A WCGPC+ I P + E++ + Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDEG 148 Query: 281 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 379 S+ NI ++PT F K G K E GA+V Sbjct: 149 GISNTISKLNITAVPTLHFFKGGSKKGEVVGADV 182 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 46.4 bits (105), Expect = 1e-05 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +2 Query: 107 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 286 + DL L AGDKLVV+DF + CG CK + PK+ +I AE Sbjct: 98 VTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKI-AEKNPEVEFLQVNYEEHR 156 Query: 287 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 376 NI+ +P F F + ++ FS N Sbjct: 157 SLCQSLNIHVLPFFRFYRGSSGRVCSFSCTN 187 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +2 Query: 89 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 268 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 269 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 367 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +2 Query: 89 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 268 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 269 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 367 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 44.8 bits (101), Expect = 4e-05 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +2 Query: 107 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 280 +K + + L++A D + V F A WCGPC++I P + E++ + Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDEG 113 Query: 281 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 379 A + N++++PT F K G K E G +V Sbjct: 114 GLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDV 147 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 44.8 bits (101), Expect = 4e-05 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 1/91 (1%) Frame = +2 Query: 107 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 286 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDVQFLQVNYEEHK 160 Query: 287 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 376 ++ +P F F + + ++ FS N Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTN 191 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.6 bits (98), Expect = 9e-05 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +2 Query: 101 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 280 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++ AE Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQL-AETNPNVMFLKVNQEE 146 Query: 281 XXXXASEYNINSMPTFVFVKNGK-KLDEFS 367 N++ +P F F + + K+ FS Sbjct: 147 LRTMCHGLNVHVLPFFKFYRGAEGKVCSFS 176 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 43.6 bits (98), Expect = 9e-05 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +2 Query: 179 ATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLD 358 A WC PCK I P ++A+ ++E+N+ + PT VF+K+G+++D Sbjct: 17 APWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEF-SNEWNVEATPTVVFLKDGRQMD 75 Query: 359 EFSGA 373 + GA Sbjct: 76 KLVGA 80 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +2 Query: 149 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 322 GD+ V ++DF ATWCGPC ++ +L+ +A E A + + +P Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 Query: 323 TFVFV 337 T F+ Sbjct: 151 TLFFI 155 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 42.3 bits (95), Expect = 2e-04 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 340 +V F A WC P + +E+A AS+ + +MPTF+F+K Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEV-ASQLEVKAMPTFLFLK 85 Query: 341 NGKKLDEFSGANVD 382 +G +D+ GAN D Sbjct: 86 DGNAMDKLVGANPD 99 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 41.5 bits (93), Expect = 4e-04 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 2/71 (2%) Frame = -2 Query: 547 KLISSN-SLQTLKTFFIHLLKTYTC-FFFLIPS*FPSAAAYNFSLYLLVFKDSCFEFVDV 374 KL+S+N S + F++ LLKTY C FFFL+ SA A F+L+ L + + E Sbjct: 108 KLLSNNHSADSSSVFYLRLLKTYVCNFFFLL-----SANASAFALFFLAY--NTLEAFGF 160 Query: 373 SAREFVQFLAI 341 S+R F FL++ Sbjct: 161 SSRNFYTFLSL 171 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 6/76 (7%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 325 +V++F A WCG C+ + P+ ++ A+E+ A+EY I PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 326 FVFVKN-GKKLDEFSG 370 ++N GK + +++G Sbjct: 109 LKILRNGGKSVQDYNG 124 Score = 38.7 bits (86), Expect = 0.003 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 7/60 (11%) Frame = +2 Query: 74 VSIYLPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 232 V+++ I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 357 VAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 40.7 bits (91), Expect = 7e-04 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +2 Query: 158 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 337 +V+++F A WCG CK + P +++A + A +Y I PT Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVF 109 Query: 338 KNGKKLDEFSGA 373 GK ++ GA Sbjct: 110 VPGKAPIDYQGA 121 Score = 33.5 bits (73), Expect = 0.099 Identities = 13/60 (21%), Positives = 24/60 (40%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 331 ++L +++F A WCG CK + P+ A + S + + PT + Sbjct: 180 NELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCDVEQSIMSRFKVQGFPTIL 239 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/72 (25%), Positives = 37/72 (51%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 340 V++ F A WCGPC+ + P L+++ +E ++I+ +PT + K Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFK 289 Query: 341 NGKKLDEFSGAN 376 G+++ + +GA+ Sbjct: 290 GGEQMAKVTGAD 301 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 325 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 326 F-VFVKNGKKLDEFSG 370 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 116 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 232 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 325 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 326 F-VFVKNGKKLDEFSG 370 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 116 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 232 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/72 (22%), Positives = 32/72 (44%) Frame = +2 Query: 158 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 337 +V+++F A WCG C+ + P +++A+ + + +Y + PT Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVF 107 Query: 338 KNGKKLDEFSGA 373 GK ++ GA Sbjct: 108 VPGKPPIDYQGA 119 Score = 35.5 bits (78), Expect = 0.024 Identities = 21/89 (23%), Positives = 35/89 (39%), Gaps = 2/89 (2%) Frame = +2 Query: 89 PKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXX 262 P S+ + S D+L T E L +++F A WCG CK + P+ + A + Sbjct: 162 PSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLG 217 Query: 263 XXXXXXXXXXASEYNINSMPTFVFVKNGK 349 S + + PT + + K Sbjct: 218 HVNCDAEQSIKSRFKVQGFPTILVFGSDK 246 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLD---EIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 331 + +DF A WCG CK + P+LD I A++ A + I++ PT + Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLM 111 Query: 332 FVKNGKKLDEFSGANVD 382 +G ++ + D Sbjct: 112 LYNHGVPMEYYGPRKAD 128 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 37.9 bits (84), Expect = 0.005 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 337 VVI +MA WC C + PKL+++AAE S + MPT Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNAVPYRLVSRAGVTKMPTIQLW 160 Query: 338 KNGKKLDEFSGAN 376 ++G+K E G + Sbjct: 161 RDGQKQAEVIGGH 173 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 328 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 329 VFVKNGK 349 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.70 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +2 Query: 155 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 334 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 335 VKNGKKLDE 361 G K E Sbjct: 520 FPAGNKTSE 528 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 328 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 329 VFVKNGK 349 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.70 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +2 Query: 155 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 334 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 335 VKNGKKLDE 361 G K E Sbjct: 520 FPAGNKTSE 528 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 337 ++I++MA+WC C + PKL+++AAE NI+ MPT Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTIQLW 180 Query: 338 KNGKKLDEFSGAN 376 K + +E G + Sbjct: 181 KEDEMKEEVIGGH 193 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 37.5 bits (83), Expect = 0.006 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +2 Query: 161 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 340 VV+ F A+WC K + +A + + Y++ ++P FVF K Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEI-SEAYSVAAVPYFVFFK 82 Query: 341 NGKKLDEFSGAN 376 +GK +D GA+ Sbjct: 83 DGKTVDTLEGAD 94 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 37.1 bits (82), Expect = 0.008 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +2 Query: 149 GDKLVVIDFMATWCGPCKMIGP---KLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 319 G KL+V+D CGPC + P KL +E + N+ + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 320 PTFVFVKNGKKLDEFSGA 373 PTF+F+++G+ + G+ Sbjct: 266 PTFLFIRDGEIRGRYVGS 283 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 37.1 bits (82), Expect = 0.008 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 2/118 (1%) Frame = +2 Query: 23 LSLACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCK 202 ++L L A ++L + I L K + + ++ E D + F WC CK Sbjct: 1 MTLGARLVAPMIILLLFIPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCK 59 Query: 203 MIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 370 +G +++ M A ++ I+S PTF+ NG+++ ++ G Sbjct: 60 KLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 37.1 bits (82), Expect = 0.008 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 2/118 (1%) Frame = +2 Query: 23 LSLACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCK 202 ++L L A ++L + I L K + + ++ E D + F WC CK Sbjct: 1 MTLGARLVAPMIILLLFIPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCK 59 Query: 203 MIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 370 +G +++ M A ++ I+S PTF+ NG+++ ++ G Sbjct: 60 KLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 37.1 bits (82), Expect = 0.008 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 2/118 (1%) Frame = +2 Query: 23 LSLACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCK 202 ++L L A ++L + I L K + + ++ E D + F WC CK Sbjct: 1 MTLGARLVAPMIILLLFIPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCK 59 Query: 203 MIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 370 +G +++ M A ++ I+S PTF+ NG+++ ++ G Sbjct: 60 KLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 36.7 bits (81), Expect = 0.011 Identities = 16/73 (21%), Positives = 28/73 (38%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 331 + +++F A WCG C+ + P+ A E+ A +Y I PT Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVF 175 Query: 332 FVKNGKKLDEFSG 370 +G+ + G Sbjct: 176 LFVDGEMRKTYEG 188 Score = 27.1 bits (57), Expect = 8.6 Identities = 15/76 (19%), Positives = 27/76 (35%) Frame = +2 Query: 155 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 334 K V+++ A WCG C+ P +++ + + PT +F Sbjct: 456 KDVLLEIYAPWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMDGTSNEHPRAKADGFPTILF 515 Query: 335 VKNGKKLDEFSGANVD 382 G K + +VD Sbjct: 516 FPGGNKSFDPIAVDVD 531 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 36.7 bits (81), Expect = 0.011 Identities = 24/85 (28%), Positives = 39/85 (45%) Frame = +2 Query: 119 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXAS 298 DD+K+ + A VI++ A+WCG C I P +++ + Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFSKLKFVYADIDECPE---T 88 Query: 299 EYNINSMPTFVFVKNGKKLDEFSGA 373 +I PTF F ++G+K+DE GA Sbjct: 89 TRHIRYTPTFQFYRDGEKVDEMFGA 113 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 36.3 bits (80), Expect = 0.014 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +2 Query: 44 FAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLD 223 F F + L LVS + + DS + + DK +++F A WCG CK + P+ + Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEV----GKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 224 EIAA 235 ++ A Sbjct: 64 KLGA 67 Score = 35.5 bits (78), Expect = 0.024 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 325 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 326 F-VFVKNGKKLDEFSG 370 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 36.3 bits (80), Expect = 0.014 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +2 Query: 44 FAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLD 223 F F + L LVS + + DS + + DK +++F A WCG CK + P+ + Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEV----GKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 224 EIAA 235 ++ A Sbjct: 64 KLGA 67 Score = 35.5 bits (78), Expect = 0.024 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 152 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 325 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 326 F-VFVKNGKKLDEFSG 370 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 35.9 bits (79), Expect = 0.019 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = +2 Query: 95 MSIHIKD--SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 268 MS +KD S + L +G LV + F A+WC K + +A + Sbjct: 1 MSGTVKDIVSKEELDNLRHSGAPLV-LHFWASWCDASKQMDQVFSHLATDFPRAHFFRVE 59 Query: 269 XXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 376 + Y++ +P FVF K+GK +D GA+ Sbjct: 60 AEEHPEI-SEAYSVALVPYFVFFKDGKTVDTLEGAD 94 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 34.3 bits (75), Expect = 0.057 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 104 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEI 229 ++ D K +++ K +++ F A WC PC+ PKL E+ Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEV 388 Score = 32.7 bits (71), Expect = 0.17 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 155 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 241 K + + F A WCGPC+ P+L E+ E+ Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNEL 72 >At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase family protein contains Pfam PF01553: Acyltransferase Length = 376 Score = 33.9 bits (74), Expect = 0.075 Identities = 18/63 (28%), Positives = 35/63 (55%) Frame = +2 Query: 29 LACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMI 208 L CF AF +I +S+++P ++ +K D L+ ++ +++ F+A+W G K Sbjct: 99 LRCFTLAFGWIIF--LSLFIPVNAL-LKGQDRLRKKIERVLVEMICSFFVASWTGVVKYH 155 Query: 209 GPK 217 GP+ Sbjct: 156 GPR 158 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 33.5 bits (73), Expect = 0.099 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +2 Query: 110 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 262 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 163 Query: 263 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 367 A I ++P F F KNG L+ F+ Sbjct: 164 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 198 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 33.5 bits (73), Expect = 0.099 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +2 Query: 110 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 262 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 150 Query: 263 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 367 A I ++P F F KNG L+ F+ Sbjct: 151 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 185 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 32.3 bits (70), Expect = 0.23 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Frame = +2 Query: 77 SIYLPKMSIHIKDSDDLKTRLA-EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 253 S+Y P I + D D L +A + G+ + + F A+WC + + PK D +++ Sbjct: 50 SLY-PTPPIEV-DGDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQ 107 Query: 254 XXXXXXXXXXXXXASEYNINSMPTFVFV 337 S Y I+S+P+ + V Sbjct: 108 HLAVEHSQALPSVFSRYGIHSLPSILMV 135 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 31.9 bits (69), Expect = 0.30 Identities = 17/82 (20%), Positives = 32/82 (39%) Frame = +2 Query: 134 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNIN 313 +L +++++ + + CGPC+ + P L+++ E A I Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIM 495 Query: 314 SMPTFVFVKNGKKLDEFSGANV 379 P F KN + L SG + Sbjct: 496 GTPCVQFFKNKEMLRTISGVKM 517 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 110 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 208 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 125 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 155 KLVVIDFMATWCGPCKMIGPKL 220 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 155 KLVVIDFMATWCGPCKMIGPKL 220 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At2g29040.1 68415.m03530 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 720 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 19 YVVTCVFLICILNCDIIFSFNLSAQDVHSHQRFRRPED 132 YV FL+ ++ +++ F+ SA+ VH+H+R R E+ Sbjct: 16 YVAMASFLLWLV---LLYLFSSSAKTVHNHERLFRQEN 50 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 420 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTKTNVG 319 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 27.5 bits (58), Expect = 6.5 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = +2 Query: 149 GDKLVVIDFMATWCGPCKMIGPKLDEIAA---EMXXXXXXXXXXXXXXXXXASEYNINSM 319 G++ V++ A WC + P+ E A E+ ASE I Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 320 PTFVFVKNGKKLDEFSGANVD 382 PT + NG L G++ + Sbjct: 153 PTLLLFVNGTSLTYNGGSSAE 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,338,793 Number of Sequences: 28952 Number of extensions: 181708 Number of successful extensions: 610 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -