BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0883 (341 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical pr... 28 1.5 U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. 28 1.5 AY303575-1|AAP57297.1| 382|Caenorhabditis elegans cell death-re... 27 2.7 AC024791-9|AAF60653.1| 382|Caenorhabditis elegans Cell-death-re... 27 2.7 Z81147-6|CAB03535.1| 506|Caenorhabditis elegans Hypothetical pr... 27 3.5 Z81097-5|CAB03168.1| 243|Caenorhabditis elegans Hypothetical pr... 27 4.7 Z50016-14|CAI06050.2| 177|Caenorhabditis elegans Hypothetical p... 27 4.7 U41546-4|AAC48218.1| 150|Caenorhabditis elegans Hypothetical pr... 27 4.7 U97406-2|AAC24293.2| 253|Caenorhabditis elegans Hypothetical pr... 26 6.1 Z69635-6|CAA93461.1| 695|Caenorhabditis elegans Hypothetical pr... 26 8.1 >Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical protein E02H4.1 protein. Length = 664 Score = 28.3 bits (60), Expect = 1.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -2 Query: 310 RFSNAYDRASSFGNTNSSSAHCLTTRRLFFAPRPGQQHAK 191 R+ + R++ +TN+++ +CLTT + + Q+H K Sbjct: 493 RYPKPWKRSAWCDSTNTTTLNCLTTEGAKLSTKENQKHCK 532 >U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. Length = 664 Score = 28.3 bits (60), Expect = 1.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -2 Query: 310 RFSNAYDRASSFGNTNSSSAHCLTTRRLFFAPRPGQQHAK 191 R+ + R++ +TN+++ +CLTT + + Q+H K Sbjct: 493 RYPKPWKRSAWCDSTNTTTLNCLTTEGAKLSTKENQKHCK 532 >AY303575-1|AAP57297.1| 382|Caenorhabditis elegans cell death-related nuclease 1 protein. Length = 382 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +3 Query: 147 EMSYGIERFFLLSYCLACCW----PGLGAKNNLRVVRQWAELEFVFPNEEARSY 296 EM +E F L L C + G+G K + ++RQ +E + N + Y Sbjct: 215 EMKLSVEEFIDLCILLGCDYCGTIRGVGPKKAVELIRQHKNIETILENIDQNKY 268 >AC024791-9|AAF60653.1| 382|Caenorhabditis elegans Cell-death-related nuclease protein1 protein. Length = 382 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +3 Query: 147 EMSYGIERFFLLSYCLACCW----PGLGAKNNLRVVRQWAELEFVFPNEEARSY 296 EM +E F L L C + G+G K + ++RQ +E + N + Y Sbjct: 215 EMKLSVEEFIDLCILLGCDYCGTIRGVGPKKAVELIRQHKNIETILENIDQNKY 268 >Z81147-6|CAB03535.1| 506|Caenorhabditis elegans Hypothetical protein T09E11.8 protein. Length = 506 Score = 27.1 bits (57), Expect = 3.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 130 WMLLNWKC-RTESSDFFYCHIVWRAVGPVS 216 W + W C T SD+FYC + R G VS Sbjct: 74 WKPIRWFCLNTTCSDYFYCSMATR-FGSVS 102 >Z81097-5|CAB03168.1| 243|Caenorhabditis elegans Hypothetical protein K07A1.7 protein. Length = 243 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 141 KLEMSYGIERFFLLSYCLACCWPGLGAKN 227 K E+S RF+L C C W KN Sbjct: 136 KTEISLDGRRFYLQQLCARCLWSDWSCKN 164 >Z50016-14|CAI06050.2| 177|Caenorhabditis elegans Hypothetical protein T21C12.8 protein. Length = 177 Score = 26.6 bits (56), Expect = 4.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 12 ESARGYIYMYLYKLNK*FYVTFY 80 E+ G Y+Y Y + K F++TF+ Sbjct: 131 ETQNGKRYVYFYSVGKTFFITFF 153 >U41546-4|AAC48218.1| 150|Caenorhabditis elegans Hypothetical protein T25B6.3 protein. Length = 150 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 123 QLLDAFKLEMSYGIERFFLLSYCLACCWPGLGAKNNLRVVRQWAELEFV 269 +L + K++MS + F + CW L KN L +W ++EF+ Sbjct: 32 ELNNLAKVDMSSASKELFQ-EFMSTLCWNNLTPKNFLENYIRWEKVEFL 79 >U97406-2|AAC24293.2| 253|Caenorhabditis elegans Hypothetical protein F40E3.2 protein. Length = 253 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 281 FVRKHELQF-RPLPHHAEIILRSETGPTARQTI 186 F++K L F + + + E + R E GP ARQT+ Sbjct: 172 FIKKGYLAFTKSVNENDEEVFRYEWGPAARQTV 204 >Z69635-6|CAA93461.1| 695|Caenorhabditis elegans Hypothetical protein F19B6.4 protein. Length = 695 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 176 KKSLDSVRHFQFKSIQQLRILF 111 KKSL S + F F S+Q + +LF Sbjct: 457 KKSLPSFKGFAFVSVQMMHMLF 478 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,790,245 Number of Sequences: 27780 Number of extensions: 151783 Number of successful extensions: 420 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 440341558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -