BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0879 (602 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC112246-1|AAI12247.1| 520|Homo sapiens poly(A)-specific ribonu... 29 9.5 AL139045-2|CAI19750.2| 520|Homo sapiens poly(A)-specific ribonu... 29 9.5 AL139045-1|CAM27947.1| 531|Homo sapiens poly(A)-specific ribonu... 29 9.5 AK097559-1|BAC05101.1| 520|Homo sapiens protein ( Homo sapiens ... 29 9.5 AK093139-1|BAC04070.1| 531|Homo sapiens protein ( Homo sapiens ... 29 9.5 >BC112246-1|AAI12247.1| 520|Homo sapiens poly(A)-specific ribonuclease (PARN)-like domain containing 1 protein. Length = 520 Score = 29.5 bits (63), Expect = 9.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 269 IKKTPS*IRQYNLVDLFQRLCKFNSNIFELEQFIIDLNKNKPDSNLAK 412 +K+ P + + + FQ LCKF+ QF++ NK K N+ K Sbjct: 427 VKRWPG-VSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARNILK 473 >AL139045-2|CAI19750.2| 520|Homo sapiens poly(A)-specific ribonuclease (PARN)-like domain containing 1 protein. Length = 520 Score = 29.5 bits (63), Expect = 9.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 269 IKKTPS*IRQYNLVDLFQRLCKFNSNIFELEQFIIDLNKNKPDSNLAK 412 +K+ P + + + FQ LCKF+ QF++ NK K N+ K Sbjct: 427 VKRWPG-VSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARNILK 473 >AL139045-1|CAM27947.1| 531|Homo sapiens poly(A)-specific ribonuclease (PARN)-like domain containing 1 protein. Length = 531 Score = 29.5 bits (63), Expect = 9.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 269 IKKTPS*IRQYNLVDLFQRLCKFNSNIFELEQFIIDLNKNKPDSNLAK 412 +K+ P + + + FQ LCKF+ QF++ NK K N+ K Sbjct: 438 VKRWPG-VSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARNILK 484 >AK097559-1|BAC05101.1| 520|Homo sapiens protein ( Homo sapiens cDNA FLJ40240 fis, clone TESTI2023752. ). Length = 520 Score = 29.5 bits (63), Expect = 9.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 269 IKKTPS*IRQYNLVDLFQRLCKFNSNIFELEQFIIDLNKNKPDSNLAK 412 +K+ P + + + FQ LCKF+ QF++ NK K N+ K Sbjct: 427 VKRWPG-VSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARNILK 473 >AK093139-1|BAC04070.1| 531|Homo sapiens protein ( Homo sapiens cDNA FLJ35820 fis, clone TESTI2006212, weakly similar to Poly(A)-specific ribonuclease (deadenylation nuclease). ). Length = 531 Score = 29.5 bits (63), Expect = 9.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 269 IKKTPS*IRQYNLVDLFQRLCKFNSNIFELEQFIIDLNKNKPDSNLAK 412 +K+ P + + + FQ LCKF+ QF++ NK K N+ K Sbjct: 438 VKRWPG-VSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARNILK 484 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,109,635 Number of Sequences: 237096 Number of extensions: 1187318 Number of successful extensions: 2122 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2122 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6354183230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -