BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0871 (594 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_1026 + 13313672-13313876,13341211-13342005,13363815-133638... 28 6.5 >03_02_1026 + 13313672-13313876,13341211-13342005,13363815-13363855, 13363967-13364140 Length = 404 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 230 SFFLSHGRCSGQQLSCAPEIC*CPWATINTYDQLG 126 S F+++G C G ++ C + CP+ T++ D G Sbjct: 27 SGFVNYGGCVGGRIGCLVSLPRCPFYTLDHLDPQG 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,373,123 Number of Sequences: 37544 Number of extensions: 319264 Number of successful extensions: 504 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -