BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0871 (594 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51318| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.2) 28 4.9 SB_35782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_29236| Best HMM Match : TMS_TDE (HMM E-Value=0) 28 4.9 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_19293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 >SB_51318| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.2) Length = 847 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -3 Query: 448 LDPRAVPPWYHCTNTSNVTRSAYINAFTISYQR 350 ++ ++VPPW+H N + V + + + T +Y R Sbjct: 342 VESKSVPPWFHPPNKTIVGSGSIVTSVTGTYVR 374 >SB_35782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -3 Query: 448 LDPRAVPPWYHCTNTSNVTRSAYINAFTISYQR 350 ++ ++VPPW+H N + V + + + T +Y R Sbjct: 504 VESKSVPPWFHPPNKTIVGSGSIVTSVTGTYVR 536 >SB_29236| Best HMM Match : TMS_TDE (HMM E-Value=0) Length = 834 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +1 Query: 157 HGHQQISGAQLSCCPLHLP*LKKNEIYIYVIAM*TCLRTTHPSST 291 +GH + CP+HL + N + I M TC RT ST Sbjct: 101 YGHAYLQSRDT--CPVHLVLISVNLLLCITILMVTCARTRQAGST 143 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = -3 Query: 439 RAVPPWYHCTNTSNVTRSAYINAFTISYQRNVL 341 ++VPPW+H N + V + + + T ++ R ++ Sbjct: 416 KSVPPWFHLPNKTIVGNGSIVTSVTGTFARRLV 448 >SB_19293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 416 MVPGWDCSRIEPVDQRYL 469 M PGW C++ EP++ R L Sbjct: 797 MCPGWGCTQTEPINNRSL 814 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,567,163 Number of Sequences: 59808 Number of extensions: 371328 Number of successful extensions: 550 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -