BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0870 (537 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29862| Best HMM Match : Enolase_N (HMM E-Value=6e-20) 100 7e-22 SB_17335| Best HMM Match : Enolase_C (HMM E-Value=0) 93 1e-19 SB_28893| Best HMM Match : Enolase_C (HMM E-Value=5.6e-07) 36 0.016 SB_21143| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.42) 29 3.2 SB_18551| Best HMM Match : RNA_pol_Rpc82 (HMM E-Value=0.69) 28 4.2 SB_9773| Best HMM Match : TPR_2 (HMM E-Value=3.2e-06) 28 4.2 SB_825| Best HMM Match : EGF (HMM E-Value=5.6e-08) 28 5.6 SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_27495| Best HMM Match : VWA (HMM E-Value=0) 27 7.3 SB_42627| Best HMM Match : DUF164 (HMM E-Value=0.33) 27 9.7 >SB_29862| Best HMM Match : Enolase_N (HMM E-Value=6e-20) Length = 115 Score = 100 bits (240), Expect = 7e-22 Identities = 46/75 (61%), Positives = 58/75 (77%) Frame = +3 Query: 96 GLFRAAVPSGASTGVHEALELRDNIKSEYHGKGVLTAIKNINELIAPELTKANLEVTQQR 275 G FRAAVPSGASTG++EALELRD S++ GKGV A+ N+N +I P L N++VT Q Sbjct: 40 GTFRAAVPSGASTGIYEALELRDKDASKFLGKGVSQAVNNVNTIIGPALVSKNVDVTAQE 99 Query: 276 EIDELMLKLDGTENK 320 +ID +ML+LDGTENK Sbjct: 100 DIDNMMLQLDGTENK 114 >SB_17335| Best HMM Match : Enolase_C (HMM E-Value=0) Length = 284 Score = 93.1 bits (221), Expect = 1e-19 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = +3 Query: 393 VPLYKHLADLAGNNDIVLPVPAFNVINGGSHAGNKLAMQEFMIFPTGA 536 VPLYK++A LAGNN ++LPVPAFNVINGGSHAGNKLAMQEFM+ PTGA Sbjct: 26 VPLYKYIAGLAGNNQVILPVPAFNVINGGSHAGNKLAMQEFMLLPTGA 73 >SB_28893| Best HMM Match : Enolase_C (HMM E-Value=5.6e-07) Length = 133 Score = 36.3 bits (80), Expect = 0.016 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 462 NVINGGSHAGNKLAMQEFMIFPTGA 536 N++NGG+HA + + +QEFMI P GA Sbjct: 2 NILNGGAHADSDVDIQEFMIAPIGA 26 >SB_21143| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.42) Length = 870 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 201 TAIKNINELIAPELTKANLEVTQQREIDELMLKLDGTENKS 323 TA KN+ + A ELT N + TQ+ + +L L TEN++ Sbjct: 679 TAKKNLEKARAAELTAVNQQATQREQ--QLTTLLQETENRN 717 >SB_18551| Best HMM Match : RNA_pol_Rpc82 (HMM E-Value=0.69) Length = 348 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 165 NIKSEYHGKGVLTAIKNINELIAPELTK--ANLEVTQQRE 278 N+K+E+ G+ AI ++ EL+ P + L++TQ R+ Sbjct: 219 NLKAEHGGEAAADAISDLQELVTPAEREMLMKLKITQARQ 258 >SB_9773| Best HMM Match : TPR_2 (HMM E-Value=3.2e-06) Length = 553 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 402 YKHLADLAGNNDIVLPVPAFNVING-GSHAGNKLAMQE 512 Y HL+ + +D+ LPV +N+ +G G G+ +A+ E Sbjct: 268 YLHLSRVKDKSDLCLPVTVYNMASGAGFVVGDAIAIPE 305 >SB_825| Best HMM Match : EGF (HMM E-Value=5.6e-08) Length = 316 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 201 TAIKNINELIAPELTKANLEVTQQREIDELMLKLDGTENKSKLGANAIL 347 T + +I E A E+T+ V + D L+++++G EN+S+ N I+ Sbjct: 230 TGVGSIEE-DAAEITERLETVATRETTDLLLIRVEGLENRSRRNNNIII 277 >SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2033 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +3 Query: 141 HEALELRDNIKSEYHGKGVLTAIKNINELIAPELTKANLEVTQ 269 H+A ++RD +G+ + IN L+AP + + +T+ Sbjct: 330 HQAQDVRDATSKALYGRLFSWIVNKINHLLAPSIESRDQHLTE 372 >SB_27495| Best HMM Match : VWA (HMM E-Value=0) Length = 1064 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 344 DSISTQFGFVLSAIQLKHEFINLSLLGYFEVGFCKFRSNEFID 216 + + T F ++ +H F + GY + GF KFRS + +D Sbjct: 633 EKLCTGFDVAERQLRKQHSFWFNDVCGYNQKGFRKFRSEQELD 675 >SB_42627| Best HMM Match : DUF164 (HMM E-Value=0.33) Length = 412 Score = 27.1 bits (57), Expect = 9.7 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +3 Query: 201 TAIKNINELIAPELTKANLEVTQQREIDELMLKLDGTENKSK 326 T + +I E +A E+T+ V + D+L+ +++G EN+S+ Sbjct: 104 TGVGSIEEDVA-EITERLETVATRETTDQLLTRVEGLENRSR 144 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,036,121 Number of Sequences: 59808 Number of extensions: 307527 Number of successful extensions: 682 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -