BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0868 (485 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006730-1|AAK72090.1| 324|Caenorhabditis elegans Serpentine re... 29 1.8 Z81124-8|CAD56599.1| 426|Caenorhabditis elegans Hypothetical pr... 29 2.4 U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of pr... 29 2.4 U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion... 29 2.4 U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion... 29 2.4 U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical pr... 27 7.2 AF101318-6|AAC69348.2| 946|Caenorhabditis elegans Hypothetical ... 27 7.2 >AC006730-1|AAK72090.1| 324|Caenorhabditis elegans Serpentine receptor, class i protein33 protein. Length = 324 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 462 LFILSNNMRYFFNLINVCFGLVRQHFNLFSHF 367 L ILS M YF L C GL+ +F ++SH+ Sbjct: 61 LTILSQPMIYFPILAGHCEGLLASYFGIWSHY 92 >Z81124-8|CAD56599.1| 426|Caenorhabditis elegans Hypothetical protein T21B4.14 protein. Length = 426 Score = 28.7 bits (61), Expect = 2.4 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 480 IFILS-FLFILSNNMRYFFNLINVCFGLVRQHFNLFSHFPMHHNPYLHF 337 IF LS FLF L N+ RYF N + F H+ + S P+ +N YL F Sbjct: 46 IFKLSNFLFELENSTRYFRN--HTTFQFNTSHYFMQSSSPL-YNYYLTF 91 >U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of presynaptic activity protein. Length = 1409 Score = 28.7 bits (61), Expect = 2.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 292 HYSEDTVPEFVKMRNKVKIWIMM 360 HY+E VPE +K +++ WI+M Sbjct: 193 HYNEPIVPEVMKEIKEIETWILM 215 >U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform b protein. Length = 1408 Score = 28.7 bits (61), Expect = 2.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 292 HYSEDTVPEFVKMRNKVKIWIMM 360 HY+E VPE +K +++ WI+M Sbjct: 193 HYNEPIVPEVMKEIKEIETWILM 215 >U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform a protein. Length = 1409 Score = 28.7 bits (61), Expect = 2.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 292 HYSEDTVPEFVKMRNKVKIWIMM 360 HY+E VPE +K +++ WI+M Sbjct: 193 HYNEPIVPEVMKEIKEIETWILM 215 >U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical protein R03G5.3 protein. Length = 1311 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 471 LSFLFILSNNMRYFFNLINVCF 406 L FLFI SNN Y+F IN+ + Sbjct: 447 LQFLFI-SNNENYYFQTINIIY 467 >AF101318-6|AAC69348.2| 946|Caenorhabditis elegans Hypothetical protein Y73C8C.8 protein. Length = 946 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 153 IYKYIKLQWILKLENPKNK--QFFFRLNAVSN*TNNKVI 263 +++ +K Q +L++ENP NK + +L VS NK+I Sbjct: 767 LFEMLKAQAVLEVENPMNKINKMTSKLIQVSKNRENKII 805 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,102,066 Number of Sequences: 27780 Number of extensions: 184486 Number of successful extensions: 417 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -