BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0868 (485 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 23 1.3 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 1.3 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 3.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.0 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.4 bits (48), Expect = 1.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 260 YLVVSSIRNCI*PKKKLFIFWV 195 YLV + RNCI P +FW+ Sbjct: 29 YLVRAFCRNCIHPTVFSVLFWL 50 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.4 bits (48), Expect = 1.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 260 YLVVSSIRNCI*PKKKLFIFWV 195 YLV + RNCI P +FW+ Sbjct: 477 YLVRAFCRNCIHPTVFSVLFWL 498 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 196 TQKINNFFLG*MQFLIE 246 T K+NN F+G +FLI+ Sbjct: 90 TDKLNNPFIGMGEFLID 106 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 4.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 173 QLNIFVDCSVTYLLQFRCFSHLFLNIFQRL 84 +L I + C V+YL+ C + + +FQ L Sbjct: 416 ELFIAIVCFVSYLIGLFCITEGGMYVFQLL 445 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 4.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 173 QLNIFVDCSVTYLLQFRCFSHLFLNIFQRL 84 +L I + C V+YL+ C + + +FQ L Sbjct: 469 ELFIAIVCFVSYLIGLFCITEGGMYVFQLL 498 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,372 Number of Sequences: 438 Number of extensions: 2169 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -