BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0867 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42049| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 2e-17 SB_22290| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) 39 0.003 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 39 0.003 SB_44774| Best HMM Match : TPR_2 (HMM E-Value=6.3e-15) 38 0.006 SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_35701| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_8404| Best HMM Match : TPR_1 (HMM E-Value=0) 37 0.011 SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.079 SB_40767| Best HMM Match : TPR_2 (HMM E-Value=3.2e-10) 34 0.079 SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) 33 0.10 SB_17634| Best HMM Match : TPR_2 (HMM E-Value=0.06) 32 0.32 SB_21064| Best HMM Match : TPR_2 (HMM E-Value=3.5e-09) 31 0.42 SB_45140| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) 31 0.42 SB_11364| Best HMM Match : TPR_2 (HMM E-Value=3e-06) 31 0.56 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_19825| Best HMM Match : TPR_2 (HMM E-Value=4.8e-30) 31 0.74 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54763| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 30 1.3 SB_42258| Best HMM Match : TPR_2 (HMM E-Value=0.006) 30 1.3 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 30 1.3 SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_49858| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_13361| Best HMM Match : TPR_2 (HMM E-Value=0.0021) 29 1.7 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 1.7 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_21585| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 29 2.2 SB_56903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 29 3.0 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 29 3.0 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_49426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_20703| Best HMM Match : TPR_1 (HMM E-Value=0) 28 3.9 SB_14077| Best HMM Match : TPR_1 (HMM E-Value=0) 28 3.9 SB_5284| Best HMM Match : CHASE3 (HMM E-Value=0.83) 28 3.9 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_54160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_46974| Best HMM Match : TPR_1 (HMM E-Value=1.5e-10) 28 3.9 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 28 3.9 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_38427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_27103| Best HMM Match : Lipoprotein_3 (HMM E-Value=10) 28 5.2 SB_21748| Best HMM Match : TPR_1 (HMM E-Value=0) 28 5.2 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_33949| Best HMM Match : TFIIB (HMM E-Value=0.0018) 28 5.2 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 28 5.2 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 27 6.9 SB_51784| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 27 6.9 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 27 6.9 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 27 6.9 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) 27 6.9 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_8976| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 27 6.9 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 27 6.9 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) 27 9.1 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 27 9.1 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 27 9.1 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_20479| Best HMM Match : Collagen (HMM E-Value=1) 27 9.1 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 27 9.1 >SB_42049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 85.4 bits (202), Expect = 2e-17 Identities = 54/132 (40%), Positives = 78/132 (59%), Gaps = 18/132 (13%) Frame = +3 Query: 162 MSNEIKIVAVSIVNFLKQQLDGDSLSPDSRESVEVGVQCIETAFELTTEDAA-------- 317 MSN ++ + +I+ L QQLD ++S DS ES+EV +QC+E F + D A Sbjct: 1 MSNSERL-SFAIIEHLTQQLDSGTVSGDSAESLEVAIQCLEQVFNINRGDEAQLKRLKTE 59 Query: 318 RGL----DLLQLVRQRLG-----PPA-NKAEAERLKNEGNELMKAERYNEALEKYTRAIE 467 R L D + ++ G P A ++ +AE LKNEGN+LMK E++ EA+ Y+RAIE Sbjct: 60 RSLQEIFDTAENLQTNGGATSMHPTAQDRQKAEELKNEGNQLMKEEKFQEAINSYSRAIE 119 Query: 468 IDPRNAVYYCNR 503 +D N+VY CNR Sbjct: 120 LDNTNSVYPCNR 131 >SB_22290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/47 (48%), Positives = 33/47 (70%) Frame = +3 Query: 372 KAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 KA+A +LK++GN + A +A+E YT AI +DP N V+Y NR+AA Sbjct: 6 KAKAAKLKDQGNAALSAGDTQKAIEFYTEAILLDPANHVFYSNRSAA 52 Score = 35.9 bits (79), Expect = 0.020 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +3 Query: 324 LDLLQLVRQRLG--PPANKAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYC 497 L+ L +RL P AE K +GNE K + A + YT AI+ +P +A Y Sbjct: 347 LEKLMKEEERLAYIDPVKSAEE---KEKGNEYFKKGDFPSAQKHYTEAIKRNPEDAKLYS 403 Query: 498 NRAA 509 NRAA Sbjct: 404 NRAA 407 Score = 33.5 bits (73), Expect = 0.10 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 369 NKAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 N+ +A K GN K + ++ A + + A E++P N +Y N AAA Sbjct: 226 NEKKAMEEKELGNAAYKKKDFDTAHKHFNNAKELNPDNMTFYTNNAAA 273 >SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +3 Query: 372 KAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRA 506 +A A +LK +GN K ++Y EA++ YT+A+ D N +Y NRA Sbjct: 117 EAVALQLKEKGNLAFKQQKYEEAVKLYTQALNQDRTNTAFYTNRA 161 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 38.7 bits (86), Expect = 0.003 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 393 KNEGNELMKAERYNEALEKYTRAIEIDPR----NAVYYCNRA 506 K EGN+ Y +A E YT A+EIDP+ NA Y NRA Sbjct: 37 KQEGNDAFTGGHYQKAYELYTEALEIDPKNKSTNAKLYYNRA 78 >SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) Length = 1104 Score = 38.7 bits (86), Expect = 0.003 Identities = 20/44 (45%), Positives = 28/44 (63%) Frame = +3 Query: 381 AERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 A R K++GN+ ++ Y E+L YTR+IE+ P A Y NRA A Sbjct: 215 ANREKDKGNDAFRSGDYKESLVYYTRSIELKP-TAASYNNRAMA 257 Score = 35.5 bits (78), Expect = 0.026 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +3 Query: 381 AERLKNEGNELMKAERYNEALEKYTRAIEI 470 A R K+EG L K RY EA+EKY++AI++ Sbjct: 415 AVRAKDEGMRLYKIGRYAEAVEKYSQAIDV 444 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 38.7 bits (86), Expect = 0.003 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 393 KNEGNELMKAERYNEALEKYTRAIEIDPR----NAVYYCNRA 506 K EGN+ Y +A E YT A+EIDP+ NA Y NRA Sbjct: 37 KQEGNDAFTGGHYQKAYELYTEALEIDPKNKSTNAKLYYNRA 78 >SB_44774| Best HMM Match : TPR_2 (HMM E-Value=6.3e-15) Length = 206 Score = 37.5 bits (83), Expect = 0.006 Identities = 19/44 (43%), Positives = 25/44 (56%) Frame = +3 Query: 381 AERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 AE K EGN + Y A+ Y++AIE P A +Y NR+AA Sbjct: 34 AEAKKAEGNREYGLKNYVSAIALYSKAIEFAPHVATFYGNRSAA 77 >SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 37.5 bits (83), Expect = 0.006 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +3 Query: 381 AERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 A LK GNE +++ A+ Y A+ + P +AV Y NRAAA Sbjct: 334 ALHLKTIGNEAFCKQQFLTAVNMYNEALNLAPNSAVLYANRAAA 377 >SB_35701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 37.1 bits (82), Expect = 0.008 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRA 506 EAE LK + N K YN A+ YT+AIE+ YY NR+ Sbjct: 186 EAEDLKLKANGYFKEGNYNSAITFYTQAIELKADVPAYYGNRS 228 >SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 37.1 bits (82), Expect = 0.008 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 5/55 (9%) Frame = +3 Query: 363 PANKAEAERLKNEGNELMKAERYNEALEKYTRAIEI-DPRN----AVYYCNRAAA 512 P+ +A+ +LK GN+ K +Y +A++ YT AIE+ P N + +Y NRAAA Sbjct: 137 PSEQAQVAKLK--GNKYFKGCKYEQAIKCYTEAIELCPPENKQDLSTFYQNRAAA 189 >SB_8404| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 1981 Score = 36.7 bits (81), Expect = 0.011 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +3 Query: 384 ERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 E+ K G+ K + + +A+E Y+ AI++DP N V Y NR+AA Sbjct: 24 EKAKWAGDACSKGD-FQKAVELYSEAIKLDPNNHVLYGNRSAA 65 >SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1769 Score = 35.5 bits (78), Expect = 0.026 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRA 506 +A + +GN+ +K E + EAL+ YT+ IE+ + + NRA Sbjct: 863 KANDFREKGNDAVKREEFQEALDWYTKGIELTKTDHRLFSNRA 905 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.079 Identities = 11/17 (64%), Positives = 16/17 (94%) Frame = -1 Query: 51 FMKLYLVPNSCSPGDPL 1 ++++YL+ NSCSPGDPL Sbjct: 3 YVRIYLISNSCSPGDPL 19 >SB_40767| Best HMM Match : TPR_2 (HMM E-Value=3.2e-10) Length = 452 Score = 33.9 bits (74), Expect = 0.079 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 393 KNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 ++EGN+ M ++ Y A++ Y ++I P N +C RA A Sbjct: 288 RSEGNKKMISKEYRTAIDLYNKSILASPINYFSWCQRATA 327 >SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) Length = 458 Score = 33.5 bits (73), Expect = 0.10 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRA 506 ++ ++ GNE+ Y A+E +T+AI++D R+ ++ NR+ Sbjct: 268 QSRQIAVRGNEMANLGNYQAAIELFTQAIKLDARDFRFFGNRS 310 >SB_17634| Best HMM Match : TPR_2 (HMM E-Value=0.06) Length = 118 Score = 31.9 bits (69), Expect = 0.32 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAI 464 +A LK EGN K + Y EA++KY RA+ Sbjct: 31 QAFSLKEEGNGCFKQKNYREAMKKYHRAM 59 >SB_21064| Best HMM Match : TPR_2 (HMM E-Value=3.5e-09) Length = 372 Score = 31.5 bits (68), Expect = 0.42 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 351 RLGPPANKAEAERLKNEGNELMKAERYNEALEKYTRAI 464 ++ P A + K EGNEL +Y +A EKY A+ Sbjct: 211 QMDPKEKLAAIPKYKEEGNELYVDGKYKDAAEKYAEAL 248 >SB_45140| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) Length = 868 Score = 31.5 bits (68), Expect = 0.42 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 381 AERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRA 506 +E K +GN+ +Y A+ YT AI P N + Y NRA Sbjct: 500 SEDRKLQGNDHFNHGKYKAAISAYTLAISGAPYNHILYGNRA 541 >SB_11364| Best HMM Match : TPR_2 (HMM E-Value=3e-06) Length = 357 Score = 31.1 bits (67), Expect = 0.56 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = +3 Query: 369 NKAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRN-----AVYYCNRAA 509 + + A L+NEGN + + ALE YT++I + P ++ Y NR+A Sbjct: 63 SSSTAASLRNEGNTYFQKRQLGRALEVYTQSILVAPSTDLKVLSLAYANRSA 114 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 K+Y V NSCSPGDPL Sbjct: 26 KVYPVSNSCSPGDPL 40 >SB_19825| Best HMM Match : TPR_2 (HMM E-Value=4.8e-30) Length = 592 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 399 EGNELMKAERYNEALEKYTRAIEIDP 476 EG+ L K E Y +AL+ Y+ A+E+ P Sbjct: 22 EGDVLFKQEEYQKALDSYSLALELKP 47 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 0.74 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 L+L+ NSCSPGDPL Sbjct: 19 LFLISNSCSPGDPL 32 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 0.97 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 ++YL NSCSPGDPL Sbjct: 8 EVYLASNSCSPGDPL 22 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 +KL + NSCSPGDPL Sbjct: 16 LKLLITSNSCSPGDPL 31 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 29.9 bits (64), Expect = 1.3 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 3/115 (2%) Frame = +3 Query: 153 KIEMSNEIKIVAVSIVNFLKQQLD--GDSLSPDSRESVEVGVQCIETAFELTTE-DAARG 323 ++E+S + I N KQ+L+ +L S + + G + EL E D A Sbjct: 384 QLELSQMDRRALREINNSAKQELNVAESNLQELSSQLGQKGRELDAAKEELRAEGDKASQ 443 Query: 324 LDLLQLVRQRLGPPANKAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAV 488 L V R N + E + N+LMK E N L++ +A+E++ N V Sbjct: 444 LVECFQVNLRDLEATNASLQETVNESTNKLMKMEEQNTRLQEQIKAVEVERVNLV 498 >SB_54763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1190 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 369 NKAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRN 482 +K + L G L+ + Y ++ E +T+ +E+DP+N Sbjct: 1048 DKENIKALFRRGKALLNLKDYEKSKEDFTQVLELDPKN 1085 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +3 Query: 366 ANKAEAERLKNEGNELMKAERYN--EALEKYTRAIEIDPRNAVYYCN 500 A++ E+ RL+ GN L+ + ++ E LEKY A +++PR+ + N Sbjct: 160 ASELESARLRICGNLLLNNDEFSKDEILEKYKEAEKLNPRDHLLQSN 206 >SB_42258| Best HMM Match : TPR_2 (HMM E-Value=0.006) Length = 154 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +3 Query: 363 PANKAEAERLKNEGNELMKAERYN----EALEKYTRAIEIDPRNAVYYCNRAAA 512 PA++A RL NE E Y+ E+++ T AI +PR YY +RA A Sbjct: 24 PASQAIRSRLSIVFNEFGILEYYDRHYLESIDYLTTAISYNPRIGPYYLSRARA 77 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 3 VDPPGCRNSARGTVS 47 VDPPGCRNS R T + Sbjct: 16 VDPPGCRNSIRSTTT 30 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 381 AERLKNEGNELMKAERYNEALEKYTRAI 464 AE+LK GNE K ++Y A +KY +A+ Sbjct: 300 AEKLKVIGNEQFKQQKYEVAKKKYKKAL 327 >SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 70 ILDLSHIYETVPRAEFLQPGGST 2 ++DL+H+ EFLQPGGST Sbjct: 25 VVDLNHLLRRHEDIEFLQPGGST 47 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 + +LV NSCSPGDPL Sbjct: 21 RAHLVSNSCSPGDPL 35 >SB_49858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 927 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +3 Query: 381 AERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAA 509 A+ N GN L + + A++ Y+RAI+I+P A + N A+ Sbjct: 398 ADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLAS 440 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +3 Query: 369 NKAEAERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAA 512 N AE N GN + + +AL Y A+++ P Y N AAA Sbjct: 111 NPMLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAA 158 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -1 Query: 60 CHTFM-KLYLVPNSCSPGDPL 1 CH ++ ++ + NSCSPGDPL Sbjct: 37 CHEWLSRVVVTSNSCSPGDPL 57 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 3/20 (15%) Frame = -1 Query: 51 FMKLYLVP---NSCSPGDPL 1 ++ YL+P NSCSPGDPL Sbjct: 3 YLPFYLIPMVSNSCSPGDPL 22 >SB_13361| Best HMM Match : TPR_2 (HMM E-Value=0.0021) Length = 304 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 393 KNEGNELMKAERYNEALEKYTRAIEIDPR----NAVYYCNRA 506 K EGN K + + +A++ YT I++ + NA+ Y NRA Sbjct: 88 KEEGNYEYKRKNFKKAIDAYTEGIKLRCQDGHVNAILYTNRA 129 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 51 FMKLYLVPNSCSPGDPL 1 ++K ++ NSCSPGDPL Sbjct: 153 YIKQWIASNSCSPGDPL 169 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 ++L+ NSCSPGDPL Sbjct: 14 VFLISNSCSPGDPL 27 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 ++Y+ NSCSPGDPL Sbjct: 47 RVYVTSNSCSPGDPL 61 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 +L+ NSCSPGDPL Sbjct: 16 FLISNSCSPGDPL 28 >SB_21585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 369 NKAEAERLKNEGNELMKAERYNEALEKYTRAIEI 470 N+ ERL + L+KAE+Y E +K A+E+ Sbjct: 166 NEKTLERLFTKAGNLVKAEKYKELAKKRAHAMEM 199 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 70 ILDLSHIYETVPRAEFLQPGGST 2 +++ S + + PR EFLQPGGST Sbjct: 29 VVNASTSFGSDPRIEFLQPGGST 51 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 M + +V NSCSPGDPL Sbjct: 3 MMIVVVSNSCSPGDPL 18 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 57 HTFMKLYLVPNSCSPGDPL 1 H + Y + NSCSPGDPL Sbjct: 24 HVTICSYRISNSCSPGDPL 42 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 M + ++ NSCSPGDPL Sbjct: 1 MTIVIISNSCSPGDPL 16 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/18 (77%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -1 Query: 51 FMKLYLVP-NSCSPGDPL 1 F L LVP NSCSPGDPL Sbjct: 22 FTTLPLVPSNSCSPGDPL 39 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y + NSCSPGDPL Sbjct: 5 YFISNSCSPGDPL 17 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 57 HTFMKLYLVPNSCSPGDPL 1 H +K L NSCSPGDPL Sbjct: 89 HEDIKRALASNSCSPGDPL 107 >SB_56903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +3 Query: 258 VEVGVQCIETAFELTTEDAARGLD-LLQLVRQRLGPPANKAEAERLKNE-GNELMKAERY 431 V++ VQ + + + ED + ++ L+Q ++ PP + AEA L +E +L K ++ Sbjct: 14 VDLDVQACKRMYTESCEDYSGNMEELVQFIKPNYTPPTDAAEALELFSEITQKLKKFHQF 73 Query: 432 NEA 440 N A Sbjct: 74 NVA 76 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 L+L NSCSPGDPL Sbjct: 5 LFLPSNSCSPGDPL 18 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 57 HTFMKLYLVPNSCSPGDPL 1 H +++ LV NSCSPGDPL Sbjct: 3 HNTLRI-LVSNSCSPGDPL 20 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T ++ L+ NSCSPGDPL Sbjct: 18 TRVRFPLISNSCSPGDPL 35 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = -1 Query: 57 HTFMKLYLVP-NSCSPGDPL 1 H K Y + NSCSPGDPL Sbjct: 4 HKIQKFYRIQSNSCSPGDPL 23 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -1 Query: 63 TCHTFMKLYLVP--NSCSPGDPL 1 T H + ++ +P NSCSPGDPL Sbjct: 127 TLHKYRLMFHLPGSNSCSPGDPL 149 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 3 VDPPGCRNSARGTVS 47 VDPPGCRNS VS Sbjct: 16 VDPPGCRNSMNANVS 30 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 +L+ NSCSPGDPL Sbjct: 39 HLISNSCSPGDPL 51 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T + +V NSCSPGDPL Sbjct: 7 TLISANIVSNSCSPGDPL 24 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 29 VSISLISNSCSPGDPL 44 >SB_49426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 314 RIFRRQLESGLNALHADFDTLSRIRAQR 231 R+ RQL + ++ +H D D +S +R R Sbjct: 246 RVLNRQLTAQIDKIHGDIDAISELRMPR 273 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 3 LVSNSCSPGDPL 14 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 L L+ NSCSPGDPL Sbjct: 35 LDLISNSCSPGDPL 48 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 17 LVSNSCSPGDPL 28 >SB_20703| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 693 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEI 470 +A+ +GNEL ++ EALE+Y +A+++ Sbjct: 11 QAQVYLRKGNELYDLGKHREALEQYQQALQV 41 >SB_14077| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 357 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEI 470 +A+ +GNEL ++ EALE+Y +A+++ Sbjct: 11 QAQVYLRKGNELYDLGKHREALEQYQQALQV 41 >SB_5284| Best HMM Match : CHASE3 (HMM E-Value=0.83) Length = 957 Score = 28.3 bits (60), Expect = 3.9 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = +3 Query: 273 QCIETAFEL-TTEDAARGLDLLQLVRQRLGPPANKAEAERLKNEGNELMKAERYNEALEK 449 + +++ F+L TT+ + LLQ R+ NK +E + EL K + NE ++K Sbjct: 200 ELLQSQFQLHTTQQKYNQIVLLQDAIYRIKQAFNKEFSEMFALKEGELKKIQEKNERIKK 259 Query: 450 YTRAIEIDPR 479 + + I+ + Sbjct: 260 ILKDLGIEEK 269 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 K + + NSCSPGDPL Sbjct: 43 KNFFISNSCSPGDPL 57 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 29 VSISLISNSCSPGDPL 44 >SB_54160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEI 470 +A+ +GNEL ++ EALE+Y +A+++ Sbjct: 11 QAQVYLRKGNELYDLGKHREALEQYQQALQV 41 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 43 TVPRAEFLQPGGST 2 TVP EFLQPGGST Sbjct: 18 TVPIIEFLQPGGST 31 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T + ++ NSCSPGDPL Sbjct: 7 TLISANIISNSCSPGDPL 24 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 ++ L+ NSCSPGDPL Sbjct: 30 RVSLISNSCSPGDPL 44 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 40 VPRAEFLQPGGST 2 VP+ EFLQPGGST Sbjct: 5 VPKIEFLQPGGST 17 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 29 VSISLISNSCSPGDPL 44 >SB_46974| Best HMM Match : TPR_1 (HMM E-Value=1.5e-10) Length = 466 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 402 GNELMKAERYNEALEKYTRAIEIDPRN 482 G +E Y EAL+ Y A++IDP N Sbjct: 421 GTAAYHSEEYVEALKDYESALKIDPNN 447 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 5 LVSNSCSPGDPL 16 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 29 VSISLISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 29 VSISLISNSCSPGDPL 44 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + ++++ NSCSPGDPL Sbjct: 61 LTVFMLSNSCSPGDPL 76 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 2 LVSNSCSPGDPL 13 >SB_38427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEI 470 +A+ +GNEL ++ EALE+Y +A+++ Sbjct: 11 QAQVYFRKGNELYNLGKHREALEQYQQALQV 41 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y + NSCSPGDPL Sbjct: 3 YSISNSCSPGDPL 15 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 29 VSISLISNSCSPGDPL 44 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 30 VSISLISNSCSPGDPL 45 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 60 CHTFMKLYLVPNSCSPGDPL 1 CH + L NSCSPGDPL Sbjct: 2 CHVSLSLR-ASNSCSPGDPL 20 >SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 +Y NSCSPGDPL Sbjct: 1 VYFTSNSCSPGDPL 14 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 +L+ NSCSPGDPL Sbjct: 6 FLLSNSCSPGDPL 18 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 29 VSISLISNSCSPGDPL 44 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T + ++ NSCSPGDPL Sbjct: 7 TLISANIISNSCSPGDPL 24 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 K+ V NSCSPGDPL Sbjct: 5 KMLRVSNSCSPGDPL 19 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + L+ NSCSPGDPL Sbjct: 27 VSISLISNSCSPGDPL 42 >SB_27103| Best HMM Match : Lipoprotein_3 (HMM E-Value=10) Length = 476 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 369 NKAEAERLKNEG-NELMKAERYNEALEKYTRAIEIDPRNAVYYCN 500 +K + K G N+ + E+L+ Y+ A+ P+ YYCN Sbjct: 378 DKTQIANSKERGKNQRPCQDSIMESLDPYSGALSTGPQGQAYYCN 422 >SB_21748| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 373 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEI 470 +A+ +GNEL ++ EALE+Y +A+++ Sbjct: 11 QAQVYFRKGNELYDLGKHREALEQYQQALQV 41 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 +K Y NSCSPGDPL Sbjct: 72 IKRYRESNSCSPGDPL 87 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 M++ NSCSPGDPL Sbjct: 3 MRVIFTSNSCSPGDPL 18 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T +++ NSCSPGDPL Sbjct: 10 TTYRMFFQSNSCSPGDPL 27 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 3/22 (13%) Frame = -1 Query: 57 HTFM--KLYLVP-NSCSPGDPL 1 H F+ K Y +P NSCSPGDPL Sbjct: 24 HPFIQAKPYNIPSNSCSPGDPL 45 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +3 Query: 3 VDPPGCRNSARG 38 VDPPGCRNS G Sbjct: 16 VDPPGCRNSIEG 27 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 L +V NSCSPGDPL Sbjct: 17 LTVVSNSCSPGDPL 30 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y + NSCSPGDPL Sbjct: 11 YALSNSCSPGDPL 23 >SB_33949| Best HMM Match : TFIIB (HMM E-Value=0.0018) Length = 720 Score = 27.9 bits (59), Expect = 5.2 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Frame = -2 Query: 485 CVSW--VDLYGARVLFKRFVVTLSFHELVAFVLESFGFSLVSGRPQSLTDKLQ*VQASSR 312 C+ W DL + + RF L HE+VA + ++G+SLV + L +KL V+ Sbjct: 634 CLEWGSTDLI-VHMNYARF---LGLHEIVAVIRAAWGWSLVH---EELPEKLHKVR---- 682 Query: 311 IFRRQLESGL 282 FRR+LE L Sbjct: 683 -FRRKLEDEL 691 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 70 LISNSCSPGDPL 81 >SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 396 NEGNELMKAERYNEALEKYTR 458 NE L + ER+N+ALEKY R Sbjct: 407 NESPALSEKERHNKALEKYKR 427 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 70 ILDLSHIYETVPRAEFLQPGGST 2 + ++S I P EFLQPGGST Sbjct: 44 VANISRIDALRPNIEFLQPGGST 66 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 L L NSCSPGDPL Sbjct: 86 LLLTSNSCSPGDPL 99 >SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 LY NSCSPGDPL Sbjct: 17 LYWESNSCSPGDPL 30 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 L L NSCSPGDPL Sbjct: 659 LQLASNSCSPGDPL 672 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 5.2 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 +++ ++ NSCSPGDPL Sbjct: 26 SYLTIHSASNSCSPGDPL 43 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 347 IVSNSCSPGDPL 358 >SB_51784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 270 VQCIETAFELTTEDAARGLD-LLQLVRQRLGPPANKAEAERLKNE 401 VQ + + + ED + ++ L+QL++ PP N AEA L +E Sbjct: 78 VQACKCMYTESCEDYSGNMEELVQLIKPNYTPPTNAAEALELFSE 122 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T +++ + NSCSPGDPL Sbjct: 57 TILEVQPLSNSCSPGDPL 74 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 3 VDPPGCRNSARGT 41 VDPPGCRNS + T Sbjct: 16 VDPPGCRNSIKRT 28 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T + ++ NSCSPGDPL Sbjct: 7 TLISANILSNSCSPGDPL 24 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 61 LSHIYETVPRAEFLQPGGST 2 +SHI EFLQPGGST Sbjct: 4 ISHIISHQSSIEFLQPGGST 23 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 Query: 3 VDPPGCRNSAR 35 VDPPGCRNS R Sbjct: 16 VDPPGCRNSIR 26 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 5/22 (22%) Frame = -1 Query: 51 FMKLYLVP-----NSCSPGDPL 1 F+ +YL P NSCSPGDPL Sbjct: 4 FLSVYLNPEVGTSNSCSPGDPL 25 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -3 Query: 55 HIYETVPRAEFLQPGGST 2 H YE R EFLQPGGST Sbjct: 223 HTYEN--RIEFLQPGGST 238 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 77 IVSNSCSPGDPL 88 >SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) Length = 1632 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 Query: 417 KAERYNEALEKYTRAIEIDPRNAVYYCN 500 K E++N A + +A+ I+P ++V YC+ Sbjct: 1447 KQEKFNLAEVHFRKALSINPSSSVLYCH 1474 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 M + + NSCSPGDPL Sbjct: 1 MAILFLSNSCSPGDPL 16 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 378 EAERLKNEGNELMKAERYNEALEKYTRAIEI 470 + E GN+L K + Y++A KY+RA ++ Sbjct: 424 DEENNSKTGNDLYKKKLYHKAFTKYSRATKL 454 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 ++++ NSCSPGDPL Sbjct: 21 IHVLSNSCSPGDPL 34 >SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1910 Score = 27.5 bits (58), Expect = 6.9 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 3/80 (3%) Frame = +3 Query: 225 GDSLSPDSRE---SVEVGVQCIETAFELTTEDAARGLDLLQLVRQRLGPPANKAEAERLK 395 G+S PD + S E Q + + T + AR L PPA + + R Sbjct: 1233 GESAIPDVQRPYGSAEPDKQAADEHHQKTAREHARTPSALVERITSPEPPATRPKHPRRV 1292 Query: 396 NEGNELMKAERYNEALEKYT 455 G L K R+N A +K T Sbjct: 1293 EAGRRLAKWNRHNRAKKKET 1312 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 1 MVSNSCSPGDPL 12 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 70 ILDLSHIYETVPRAEFLQPGGST 2 ++ L++ Y T P EFLQPGGST Sbjct: 14 LIPLTYPYYTPP-IEFLQPGGST 35 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 57 HTFMKLYLVPNSCSPGDPL 1 H+ + + + NSCSPGDPL Sbjct: 77 HSGLNEHSLSNSCSPGDPL 95 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 70 ILDLSHIYETVPRAEFLQPGGST 2 +L L H T P EFLQPGGST Sbjct: 5 LLTLQH---TKPTIEFLQPGGST 24 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 85 IVSNSCSPGDPL 96 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 +++ NSCSPGDPL Sbjct: 103 FILSNSCSPGDPL 115 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 6 IVSNSCSPGDPL 17 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 1 MVSNSCSPGDPL 12 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +3 Query: 3 VDPPGCRNSARG 38 VDPPGCRNS G Sbjct: 92 VDPPGCRNSIAG 103 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 +++ NSCSPGDPL Sbjct: 11 FILSNSCSPGDPL 23 >SB_8976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 270 VQCIETAFELTTEDAARGLD-LLQLVRQRLGPPANKAEAERLKNEGNELMK 419 VQ + + + ED + ++ L+QL++ PP + AEA +L +E + +K Sbjct: 75 VQACKRMYTESCEDYSGNMEELVQLIKPNYTPPTDAAEALKLFSEITQKLK 125 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 K+ + NSCSPGDPL Sbjct: 16 KVSITSNSCSPGDPL 30 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +3 Query: 3 VDPPGCRNSARG 38 VDPPGCRNS G Sbjct: 103 VDPPGCRNSITG 114 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T + + NSCSPGDPL Sbjct: 7 TLISANIASNSCSPGDPL 24 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/17 (70%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = -1 Query: 48 MKLYLVP-NSCSPGDPL 1 M L++ P NSCSPGDPL Sbjct: 11 MVLHVPPSNSCSPGDPL 27 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/15 (80%), Positives = 13/15 (86%), Gaps = 1/15 (6%) Frame = -1 Query: 42 LYLVP-NSCSPGDPL 1 L L+P NSCSPGDPL Sbjct: 22 LQLLPSNSCSPGDPL 36 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y NSCSPGDPL Sbjct: 8 YKTSNSCSPGDPL 20 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 3 VDPPGCRNSARGT 41 VDPPGCRNS G+ Sbjct: 16 VDPPGCRNSMIGS 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 ++ NSCSPGDPL Sbjct: 17 IISNSCSPGDPL 28 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 3 VDPPGCRNSARGTVS*MCDK 62 VDPPGCRNS + DK Sbjct: 16 VDPPGCRNSIHKALDAAIDK 35 >SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2639 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 314 RIFRRQLESGLNALHADFDTLSRIRAQRIAVQLLF*KVHDTHCNY 180 R+ RQ + ++ LH D D +S + I LL+ V + N+ Sbjct: 2169 RVLDRQFTAQIDKLHGDIDAISEVEVNTINEILLYTSVAVSLLNF 2213 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 62 LLSNSCSPGDPL 73 >SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 314 RIFRRQLESGLNALHADFDTLSRIRAQRIAVQLLF*KVHDTHCNY 180 R+ RQ + ++ LH D D +S + I LL+ V + N+ Sbjct: 1324 RVLDRQFTAQIDKLHGDIDAISEVEVNTINEILLYTSVAVSLLNF 1368 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 51 FMKLYLVPNSCSPGDPL 1 + K+ + NSCSPG+PL Sbjct: 11 YRKIVSISNSCSPGEPL 27 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 ++ NSCSPGDPL Sbjct: 119 IISNSCSPGDPL 130 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -1 Query: 54 TFMKLYLVP-NSCSPGDPL 1 TF K + V NSCSPGDPL Sbjct: 10 TFGKSFRVTSNSCSPGDPL 28 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 + V NSCSPGDPL Sbjct: 32 FKVSNSCSPGDPL 44 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 60 CHTFMKLYLVPNSCSPGDPL 1 C F + + NSCSPGDPL Sbjct: 4 CKWFDIKHDISNSCSPGDPL 23 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 3/22 (13%) Frame = -1 Query: 57 HTFMKL-YL--VPNSCSPGDPL 1 HT M+ Y+ + NSCSPGDPL Sbjct: 41 HTLMECDYVNDISNSCSPGDPL 62 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 + L NSCSPGDPL Sbjct: 76 ILLTSNSCSPGDPL 89 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 + V NSCSPGDPL Sbjct: 30 FRVSNSCSPGDPL 42 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y NSCSPGDPL Sbjct: 10 YSASNSCSPGDPL 22 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 3474 VVSNSCSPGDPL 3485 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 +L + NSCSPGDPL Sbjct: 148 RLEKISNSCSPGDPL 162 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 60 CHTFMKLYLVPNSCSPGDPL 1 C+T L + NSCSPGDPL Sbjct: 180 CYT--DLVIQSNSCSPGDPL 197 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 49 YETVPRAEFLQPGGST 2 Y P EFLQPGGST Sbjct: 3 YSVSPYIEFLQPGGST 18 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y NSCSPGDPL Sbjct: 5 YRTSNSCSPGDPL 17 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 ++ NSCSPGDPL Sbjct: 14 IISNSCSPGDPL 25 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 54 LLSNSCSPGDPL 65 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 48 MKLYLVPNSCSPGDPL 1 + + V NSCSPGDPL Sbjct: 14 ISIAFVSNSCSPGDPL 29 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 54 TFMKLYLVPNSCSPGDPL 1 T + + NSCSPGDPL Sbjct: 7 TLISANITSNSCSPGDPL 24 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 2 LLSNSCSPGDPL 13 >SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 49 YETVPRAEFLQPGGST 2 +ET+ EFLQPGGST Sbjct: 21 FETLEFIEFLQPGGST 36 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +3 Query: 3 VDPPGCRNSARG 38 VDPPGCRNS G Sbjct: 33 VDPPGCRNSIDG 44 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 396 NEGNELMKAERYNEALEKYTRAIEIDPRNAVYY 494 N N+ + + +++ LE+Y R++E D V+Y Sbjct: 15 NPNNKFLSLKHFHDYLEQYERSMEFDISCIVHY 47 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 6 LLSNSCSPGDPL 17 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 + + V NSCSPGDPL Sbjct: 11 RCWQVSNSCSPGDPL 25 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y + NSCSPGDPL Sbjct: 8 YELSNSCSPGDPL 20 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 57 HTFMKLYLVPNSCSPGDPL 1 H L NSCSPGDPL Sbjct: 4 HILCTQELTSNSCSPGDPL 22 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 45 KLYLVPNSCSPGDPL 1 ++ V NSCSPGDPL Sbjct: 6 RITAVSNSCSPGDPL 20 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 ++ NSCSPGDPL Sbjct: 1 MISNSCSPGDPL 12 >SB_20479| Best HMM Match : Collagen (HMM E-Value=1) Length = 1214 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 314 RIFRRQLESGLNALHADFDTLSRIRAQRIAVQLLF*KVHDTHCNY 180 R+ RQ + ++ LH D D +S + I LL+ V + N+ Sbjct: 126 RVLDRQFTAQIDKLHGDIDAISEVEVNTINEILLYTSVAVSLLNF 170 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 42 LYLVPNSCSPGDPL 1 + L NSCSPGDPL Sbjct: 9 IMLASNSCSPGDPL 22 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 1 LLSNSCSPGDPL 12 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 ++ NSCSPGDPL Sbjct: 4 IISNSCSPGDPL 15 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/14 (78%), Positives = 13/14 (92%), Gaps = 1/14 (7%) Frame = -1 Query: 39 YLVP-NSCSPGDPL 1 +L+P NSCSPGDPL Sbjct: 20 FLLPSNSCSPGDPL 33 >SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 39 YLVPNSCSPGDPL 1 Y NSCSPGDPL Sbjct: 3 YKASNSCSPGDPL 15 >SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 670 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 314 RIFRRQLESGLNALHADFDTLSRIRAQRIAVQLLF*KVHDTHCNY 180 R+ RQ + ++ LH D D +S + I LL+ V + N+ Sbjct: 544 RVLDRQFTAQIDKLHGDIDAISEVEVNTINEILLYSSVAVSLLNF 588 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 27 VVSNSCSPGDPL 38 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 36 LVPNSCSPGDPL 1 ++ NSCSPGDPL Sbjct: 26 IISNSCSPGDPL 37 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 60 CHTFMKLYLVP-NSCSPGDPL 1 C+ + L+ NSCSPGDPL Sbjct: 136 CNLLFSINLITSNSCSPGDPL 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,091,968 Number of Sequences: 59808 Number of extensions: 235579 Number of successful extensions: 2531 Number of sequences better than 10.0: 186 Number of HSP's better than 10.0 without gapping: 2467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2530 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -