BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0867 (513 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 1.4 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 23 2.4 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 5.7 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 5.7 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 5.7 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 5.7 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 5.7 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 5.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 5.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 5.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 5.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 5.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 5.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 5.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 5.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 5.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 5.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 5.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 5.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 5.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 5.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 5.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 5.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 5.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 5.7 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 5.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 5.7 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 21 7.5 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 7.5 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.5 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.5 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 21 9.9 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 21 9.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.9 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 347 TDKLQ*VQASSRIFRRQLESGLNALHADFDTLS 249 +D + + SRI ++ S LNA+++ FDTL+ Sbjct: 428 SDVVTFTEICSRITPMEVVSMLNAMYSLFDTLT 460 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 360 PPANKAEAERLKNEGNELMKAERYNEA 440 PP ++A E +K E + +K YN A Sbjct: 160 PPYSEARFEEIKKEVSSYIKKIGYNTA 186 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 51 KNENSYRKYRETSK 64 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 51 KNENSYRKYRETSK 64 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 51 KNENSYRKYRETSK 64 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 51 KNENSYRKYRETSK 64 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 51 KNENSYRKYRETSK 64 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 51 KNENSYRKYRETSK 64 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 273 KNENSYRKYRETSK 286 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 273 KNENSYRKYRETSK 286 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 289 KNENSYRKYRETSK 302 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 380 SRTTQERRQRAHES*ALQRSA*KVHAR 460 SRT +ER Q E+ +Q+ + H R Sbjct: 29 SRTKEERLQHRREAWLIQQEREREHQR 55 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 170 RNQNSCSEYRELSK 211 +N+NS +YRE SK Sbjct: 284 KNENSYRKYRETSK 297 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 360 PPANKAEAERLKNEGNELMKAERYNEA 440 PP ++ E +K E + +K YN A Sbjct: 87 PPYSETRFEEIKKEVSSYIKKIGYNPA 113 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 360 PPANKAEAERLKNEGNELMKAERYNEA 440 PP ++ E +K E + +K YN A Sbjct: 103 PPYSETRFEEIKKEVSSYIKKIGYNPA 129 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 360 PPANKAEAERLKNEGNELMKAERYNEA 440 PP ++ E +K E + +K YN A Sbjct: 160 PPYSETRFEEIKKEVSSYIKKIGYNPA 186 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 46 ETVPRAEFLQPGGS 5 E + EFL PGGS Sbjct: 63 EIYAKCEFLNPGGS 76 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -2 Query: 368 SGRPQSLTDKLQ*VQASSRIFRRQLESGLNALHAD 264 SGR + ++L + R RRQL+ L D Sbjct: 28 SGRSRVSDEQLNMALSDQRYLRRQLKCALGEAPCD 62 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -2 Query: 368 SGRPQSLTDKLQ*VQASSRIFRRQLESGLNALHAD 264 SGR + ++L + R RRQL+ L D Sbjct: 28 SGRSRVSDEQLNMALSDQRYLRRQLKCALGEAPCD 62 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 20.6 bits (41), Expect = 9.9 Identities = 6/22 (27%), Positives = 11/22 (50%) Frame = +1 Query: 25 IRHEVQFHKCVTSLKSTFCVNW 90 +RH + HKC +++ W Sbjct: 552 VRHNLSLHKCFMRVENVKGAVW 573 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,361 Number of Sequences: 438 Number of extensions: 2122 Number of successful extensions: 43 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -