BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0864 (636 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40550.1 68415.m05003 expressed protein 38 0.006 At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.4 At5g59500.1 68418.m07457 expressed protein 28 6.0 At4g10550.1 68417.m01727 subtilase family protein contains simil... 28 6.0 At2g45040.1 68415.m05607 matrix metalloproteinase nearly identic... 28 6.0 >At2g40550.1 68415.m05003 expressed protein Length = 589 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = +2 Query: 422 QIPLINSNASHNLTDGNLVRFRGMIQDMHNPEFY 523 Q+P+++S++ + LVRFRGMIQDM EFY Sbjct: 56 QVPILDSSSIKWVQPKTLVRFRGMIQDMLGNEFY 89 >At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein predicted proteins, Arabidopsis thaliana and Drosophila melanogaster contains Pfam profile PF00564: PB1 domain Length = 531 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +2 Query: 320 HENIMSDIETTTPDRWIENEKIMKSKLMKLPNWYQIP-LINSNASHNLTDGNLVRFRGMI 496 + NI +I TTT E ++ + ++ +P Q P + + GN + + Sbjct: 352 NSNIQGNIYTTTSQNLPEQQQ-QQQQVYMIPAQSQAPGTLYQSVMRPTVQGNQGYYPSPV 410 Query: 497 QDMHNPEFYFEK 532 Q +H+P+ Y E+ Sbjct: 411 QRLHHPDAYMEQ 422 >At5g59500.1 68418.m07457 expressed protein Length = 396 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 397 LALHYFFILNPSIRRRCF 344 LA HYFF N S+R+R + Sbjct: 214 LAYHYFFFFNVSVRKRLY 231 >At4g10550.1 68417.m01727 subtilase family protein contains similarity to subtilisin-like protease AIR3 GI:4218991 from [Arabidopsis thaliana] Length = 778 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = -1 Query: 579 PLLTFTSFVVVLNTSNFSK*NSGLCMSWIMPLNRTKFPSVKLC 451 P L FTS V N N ++ SG C + NRT V LC Sbjct: 382 PGLGFTSLVYPENPGNSNESFSGTCEELLFNSNRTMEGKVVLC 424 >At2g45040.1 68415.m05607 matrix metalloproteinase nearly identical to metalloproteinase [Arabidopsis thaliana] GI:3128477; contains InterPro accession IPR001818: Matrixin Length = 342 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 410 PNWYQIPLINSNASHNLTDGNLVRFRGMI 496 PN+ L+ S S NL DG+ +R +GMI Sbjct: 299 PNFTLNSLLASETSTNLADGSRIRSQGMI 327 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,104,083 Number of Sequences: 28952 Number of extensions: 222032 Number of successful extensions: 468 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -