BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0861 (581 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|... 28 1.1 SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 27 2.0 SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|... 27 2.0 SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 4.6 SPACUNK4.12c |mug138||metallopeptidase|Schizosaccharomyces pombe... 25 6.1 SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p... 25 6.1 >SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 699 Score = 27.9 bits (59), Expect = 1.1 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 95 GESDPRNPTASSC*KTRCGESQRGKEAKSETPKAGQGGGSR*S*KVQTG 241 GES+ N T++S K R + K+AK ET K+G + S K+ G Sbjct: 297 GESNKDNNTSTSKHKKRPKRLSKFKQAKLETKKSGNKDHATSSEKLSLG 345 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 27.1 bits (57), Expect = 2.0 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -1 Query: 437 AVVDVEFGFDVIHQIQDVFDDRLLLCLDHFVH-LFDLNFGLGIDLGR 300 A VDVE V I++ F+DR +L + H ++ + D N L +D G+ Sbjct: 1389 AAVDVETDAIVQRTIRERFNDRTILTIAHRINTVMDSNRILVLDHGK 1435 >SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|||Manual Length = 1369 Score = 27.1 bits (57), Expect = 2.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 98 ESDPRNPTASSC*KTRCGESQRGKEAKSETPKAGQGGG 211 E+DP+NP A S G + +++K+E PK G Sbjct: 1284 ENDPKNPKAGS---QGSGNTSASEDSKTEKPKTRTNNG 1318 >SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 867 Score = 25.8 bits (54), Expect = 4.6 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 421 SSGLMSYTRFKTSLMTASFCVWTILFISSILTLVSASILA 302 SSGL+ K +S + +L I S LTLV +S ++ Sbjct: 732 SSGLLELIALKIGNAVSSLNTFRVLLIFSALTLVVSSFIS 771 >SPACUNK4.12c |mug138||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 25.4 bits (53), Expect = 6.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 92 IENTQKLCRPRPSTRTETRINKAILVP 12 IE+ QKL P+P ++ +AI+VP Sbjct: 704 IESAQKLIDPKPVFASQLSRKRAIIVP 730 >SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 25.4 bits (53), Expect = 6.1 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = +1 Query: 136 KNALRRKSARQGSEKRNA*SRPRRRLKMKLKSTDRSVKGSSKNLKPSTWVPXKVLRPRSM 315 +N R+K R+ +E+RN + R R+ K K + GS +++ + W+ + R + Sbjct: 167 ENRERKKRWREQNEERNKDNDLRCRVNKKAK----KLFGSEPSIEKTNWIEAEFTRRHTK 222 Query: 316 PRPK 327 + K Sbjct: 223 RKEK 226 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,982,781 Number of Sequences: 5004 Number of extensions: 33550 Number of successful extensions: 93 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -