BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0861 (581 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) 31 0.69 SB_43807| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 30 1.6 SB_31407| Best HMM Match : TolA (HMM E-Value=2.5) 29 2.1 SB_43805| Best HMM Match : YscO (HMM E-Value=6) 29 2.1 SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_11766| Best HMM Match : Reprolysin (HMM E-Value=1.6e-08) 28 4.8 SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_24780| Best HMM Match : Linker_histone (HMM E-Value=0.0023) 28 6.4 SB_1788| Best HMM Match : Linker_histone (HMM E-Value=0.0023) 28 6.4 SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) 27 8.5 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_49433| Best HMM Match : DUF1327 (HMM E-Value=3.1) 27 8.5 >SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) Length = 381 Score = 31.1 bits (67), Expect = 0.69 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +1 Query: 148 RRKSARQGSEKRNA*SRPRRRLKMKLKSTDRSVKGSSKNLKPS 276 RRKS + ++R + SR RRR K +S +RS K S+ + S Sbjct: 317 RRKSRSRSRDRRRSRSRERRRDDRKRRSRERSPKRRSREREES 359 >SB_43807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 30.7 bits (66), Expect = 0.91 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +3 Query: 300 AAKIDAETKVKIEEMNKMVQTQKEAVIKDVLNLVYDIKPELHINYRL 440 AAK + +++IE +NK ++ KE + D + Y ++ E + N+ L Sbjct: 7 AAKREELKEMRIEMVNKAIEESKEFITPDDEKIAYALENETNYNFAL 53 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +1 Query: 103 RPKESNSF*LLKNALRRKSARQGSEKRNA*SRPRRRLKMKLKSTDRSVKGS 255 RP++++S K A R + ARQ S + N ++ K + T R +K S Sbjct: 405 RPRQASSKTKYKQAARPRQARQASHRTNKLQDQNKQDKQAARPTSRRIKTS 455 >SB_31407| Best HMM Match : TolA (HMM E-Value=2.5) Length = 315 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 276 HMGTXEGVAAKIDAETK-VKIEEMNKMVQTQKEAVIKDVLN--LVYDIKPELHINYRL 440 H + AAK + E K ++IE +NK ++ KE + D L+ + Y ++ E + N+ L Sbjct: 136 HQMKKKAKAAKREEELKEMRIEIVNKAIEESKEFITPDNLDKKIAYALENETNYNFAL 193 >SB_43805| Best HMM Match : YscO (HMM E-Value=6) Length = 243 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 276 HMGTXEGVAAKIDAETK-VKIEEMNKMVQTQKEAVIKDVLN--LVYDIKPELHINYRL 440 H + AAK + E K ++IE +NK ++ KE + D L+ + Y ++ E + N+ L Sbjct: 136 HQMKKKAKAAKREEELKEMRIEIVNKAIEESKEFITPDNLDKKIAYALENETNYNFAL 193 >SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 28.7 bits (61), Expect = 3.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 246 HAPVCTFQLHLEPPPW 199 HAP+CT ++ L PPW Sbjct: 201 HAPLCTKRVRLSKPPW 216 >SB_11766| Best HMM Match : Reprolysin (HMM E-Value=1.6e-08) Length = 469 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 516 FFLNKGDQIKLIRRKLCIKYNNLLNLSGS*CGVRV*C 406 FF + D + I+ CI N+L + G+ CG R C Sbjct: 385 FFQQRCDSLLCIKGSKCINPRNILPVDGTPCGNRKWC 421 >SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2978 Score = 27.9 bits (59), Expect = 6.4 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = -3 Query: 195 ALGVSLFASLPR*LSPQRVFQQLEAVGFLGSDSPYRKHTKTM*TKTE 55 ALG+ + + ++ + V +++ + F+ + +PYRKHT M K E Sbjct: 2447 ALGLIKEVMVDKRVNGRPVGEEIRRLHFIAACNPYRKHTDQMIHKLE 2493 >SB_24780| Best HMM Match : Linker_histone (HMM E-Value=0.0023) Length = 186 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 130 LLKNALRRKSARQGSEKRNA*SRPRRRLKMKLKSTDRSVK 249 L K + + + S+KRNA RPR K K ++ R VK Sbjct: 126 LTKKSKSKSRKSKASKKRNARRRPRSARKTKSRAPARRVK 165 >SB_1788| Best HMM Match : Linker_histone (HMM E-Value=0.0023) Length = 186 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 130 LLKNALRRKSARQGSEKRNA*SRPRRRLKMKLKSTDRSVK 249 L K + + + S+KRNA RPR K K ++ R VK Sbjct: 126 LTKKSKSKSRKSKASKKRNARRRPRSARKTKSRAPARRVK 165 >SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) Length = 3342 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 291 EGVAAKIDAETKVKIEEMNKMVQTQKEAVIKDVLNLVYDIKP 416 E K DA T ++E+++K+++ + E +IK+ YD+KP Sbjct: 1737 EKAIIKHDATT-AELEKIDKLLRGKIEQLIKEHTKKKYDVKP 1777 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 303 AKIDAETKVKIEEMNKMVQTQKEAVIKD 386 AK+D E K K +NKM ++E +I D Sbjct: 2455 AKLDGEFKGKYYPLNKMTDEEQEQLIND 2482 >SB_49433| Best HMM Match : DUF1327 (HMM E-Value=3.1) Length = 728 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +1 Query: 70 HSFCVFSIWRVRPKESNSF-*LLKNALRRKSARQGSEKR-NA*SRPRRRLKMKLKSTDRS 243 H C+ +W + K S++F LK+ RR+SA+ K NA ++ K + S Sbjct: 634 HLRCLLKMWTLEKKTSSTFINALKHRRRRRSAKNKYRKHINANHEKTQKSVRKKNEPELS 693 Query: 244 VKGSSKNL 267 V G L Sbjct: 694 VIGKESIL 701 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,760,646 Number of Sequences: 59808 Number of extensions: 244768 Number of successful extensions: 718 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -