BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0861 (581 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04390.1 68417.m00627 Ulp1 protease family protein contains P... 29 3.0 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 28 5.2 At5g47150.1 68418.m05812 YDG/SRA domain-containing protein low s... 27 6.9 At4g23710.1 68417.m03412 vacuolar ATP synthase subunit G 2 (VATG... 27 6.9 At1g14460.1 68414.m01715 DNA polymerase-related weak similarity ... 27 6.9 At1g44810.1 68414.m05133 expressed protein contains Pfam profil... 27 9.1 >At4g04390.1 68417.m00627 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 963 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 79 CVFSIWRVRPKESNSF*LLKNALRRKSARQGSEKRNA 189 CV S V PK+ +LK RKSA+QG K+N+ Sbjct: 340 CVPSEVVVAPKKRKKSAMLKGGRGRKSAKQGRFKKNS 376 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = +3 Query: 300 AAKIDAETKVKIEEMNKMVQTQKEAVIKDVLNLVYD---IKPELH 425 AA++ + K+ MNK++ + + + K V NLVY+ +K +LH Sbjct: 87 AARLQTVNR-KLNAMNKLLMEENDRLQKQVSNLVYENGHMKHQLH 130 >At5g47150.1 68418.m05812 YDG/SRA domain-containing protein low similarity to nuclear protein np95 [Mus musculus] GI:4220590; contains Pfam profile PF02182: YDG/SRA domain Length = 328 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +3 Query: 270 AKHMGTXEGVAAKIDAETKVKIEEMNKMVQTQKEAVIKDVLNL--VYDIKPELHI 428 A+ G ++ID +T +E+M K V T+K +N+ V+ K EL + Sbjct: 141 ARRGGDFLDATSRIDLKTLTVLEKMGKQVNTEKRIGSVPGINIGDVFQYKTELRV 195 >At4g23710.1 68417.m03412 vacuolar ATP synthase subunit G 2 (VATG2) / V-ATPase G subunit 2 (VAG2) / vacuolar proton pump G subunit 2 identical to Swiss-Prot:O82629 vacuolar ATP synthase subunit G 2 (V-ATPase G subunit 2, Vacuolar proton pump G subunit 2) [Arabidopsis thaliana] Length = 106 Score = 27.5 bits (58), Expect = 6.9 Identities = 22/93 (23%), Positives = 35/93 (37%), Gaps = 1/93 (1%) Frame = +3 Query: 102 QTQGIQQLLAAEKRAAEKVSXXXXXXXXXXXXXXXXXXDEVXXXXXXXXXXXXXXXAKHM 281 ++ GIQQLLAAE+ A + V+ EV Sbjct: 2 ESAGIQQLLAAEREAQQIVNAARTAKMTRLKQAKEEAETEVAEHKTSTEQGFQRKLEATS 61 Query: 282 GTXEGVAAKIDAETKVKIEEM-NKMVQTQKEAV 377 G +++ ET KIE++ N+ + K+ V Sbjct: 62 GDSGANVKRLEQETDAKIEQLKNEATRISKDVV 94 >At1g14460.1 68414.m01715 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1116 Score = 27.5 bits (58), Expect = 6.9 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +1 Query: 142 ALRRKSARQGSEKRNA*SRPRRRLKMKLKSTDRSVKGSSKNLKPSTWVPXKVLRPRSMPR 321 AL K + ++RN RLK LK + K + STW +L+ SMP Sbjct: 719 ALDEKYSEAFLDRRNLTEADLERLKHALKLLSEAEKQLRVSTDRSTWFIATLLQLGSMPS 778 Query: 322 P 324 P Sbjct: 779 P 779 >At1g44810.1 68414.m05133 expressed protein contains Pfam profile: PF04504 protein of unknown function, DUF573 Length = 296 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/36 (27%), Positives = 24/36 (66%) Frame = +3 Query: 303 AKIDAETKVKIEEMNKMVQTQKEAVIKDVLNLVYDI 410 +K+ ETK +IEE KMV+ ++ ++ ++++ ++ Sbjct: 253 SKVSKETKKRIEEKMKMVEAKELELLSQKIDVLKEV 288 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,400,058 Number of Sequences: 28952 Number of extensions: 177422 Number of successful extensions: 510 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -