BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0858 (323 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) 45 2e-05 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 42 9e-05 SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) 42 9e-05 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 2e-04 SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) 41 2e-04 SB_21018| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.001 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.003 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.003 SB_50830| Best HMM Match : RVT_1 (HMM E-Value=0.04) 36 0.010 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.013 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.013 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.013 SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) 35 0.013 SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) 35 0.013 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 35 0.013 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 35 0.013 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.013 SB_2306| Best HMM Match : MecA_N (HMM E-Value=2.3) 35 0.013 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 34 0.023 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 34 0.023 SB_25036| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.030 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 34 0.030 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.030 SB_44362| Best HMM Match : Transposase_24 (HMM E-Value=6.3) 33 0.040 SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) 33 0.040 SB_20796| Best HMM Match : RVT_1 (HMM E-Value=0.047) 33 0.040 SB_44245| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.053 SB_27819| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.053 SB_26738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.053 SB_7619| Best HMM Match : ArfGap (HMM E-Value=5.3) 33 0.053 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.053 SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 33 0.053 SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) 33 0.053 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 33 0.070 SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) 32 0.093 SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.093 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 32 0.093 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.12 SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.12 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.12 SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.12 SB_15909| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.16 SB_2139| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.16 SB_34486| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.16 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.16 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.16 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.16 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 31 0.21 SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.21 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 31 0.21 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.21 SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) 31 0.21 SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) 31 0.21 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 31 0.21 SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) 31 0.21 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 31 0.21 SB_19445| Best HMM Match : DUF104 (HMM E-Value=7.3) 31 0.21 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.21 SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) 31 0.21 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.21 SB_49847| Best HMM Match : VAR1 (HMM E-Value=5.2) 31 0.21 SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.21 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.21 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 31 0.21 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 31 0.21 SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) 31 0.21 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) 31 0.28 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_21205| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.75) 31 0.28 SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4) 31 0.28 SB_58944| Best HMM Match : fn3 (HMM E-Value=0.88) 31 0.28 SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 31 0.28 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 31 0.28 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.28 SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) 31 0.28 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 31 0.28 SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) 31 0.28 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_18313| Best HMM Match : Trans_reg_C (HMM E-Value=0.91) 31 0.28 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 31 0.28 SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) 31 0.28 SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.38 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.38 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 30 0.38 SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049) 30 0.38 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 30 0.38 SB_23376| Best HMM Match : GPS (HMM E-Value=1.2) 30 0.38 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 30 0.38 SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_50266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 30 0.50 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 30 0.50 SB_31795| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 30 0.50 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 30 0.50 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 30 0.50 SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 30 0.50 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 30 0.50 SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_39518| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 30 0.50 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 30 0.50 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.50 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) 30 0.50 SB_53821| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.66 SB_46086| Best HMM Match : RVT_1 (HMM E-Value=1.6e-20) 29 0.66 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 29 0.66 SB_21517| Best HMM Match : UCR_UQCRX_QCR9 (HMM E-Value=7.2) 29 0.66 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.66 SB_55982| Best HMM Match : Transposase_11 (HMM E-Value=2.3) 29 0.66 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.66 SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031) 29 0.66 SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.66 SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_19870| Best HMM Match : RVT_1 (HMM E-Value=0.18) 29 0.87 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 29 0.87 SB_14210| Best HMM Match : RVT_1 (HMM E-Value=0.2) 29 0.87 SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6) 29 0.87 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_24103| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_20248| Best HMM Match : GPS (HMM E-Value=1.5) 29 0.87 SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) 29 0.87 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) 29 0.87 SB_4166| Best HMM Match : RVT_1 (HMM E-Value=0.00088) 29 0.87 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 28 1.5 SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) 28 1.5 SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) 28 1.5 SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_50175| Best HMM Match : fn3 (HMM E-Value=1.3e-12) 28 2.0 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 28 2.0 SB_40727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 28 2.0 SB_23048| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 28 2.0 SB_58776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_27920| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 27 2.6 SB_15616| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_40921| Best HMM Match : Choline_kin_N (HMM E-Value=2.8) 27 2.6 SB_21914| Best HMM Match : Exo_endo_phos (HMM E-Value=6e-05) 27 2.6 SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_50373| Best HMM Match : HC2 (HMM E-Value=0.001) 27 3.5 SB_23637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_16024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 27 3.5 SB_7671| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_46645| Best HMM Match : Exo_endo_phos (HMM E-Value=0.044) 27 3.5 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_41660| Best HMM Match : PyrI_C (HMM E-Value=4.6) 27 4.6 SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 27 4.6 SB_57036| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_43011| Best HMM Match : AgrD (HMM E-Value=3.4) 27 4.6 SB_19955| Best HMM Match : AFP (HMM E-Value=0.14) 27 4.6 SB_12971| Best HMM Match : RBB1NT (HMM E-Value=4.1) 27 4.6 SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) 26 6.1 SB_8909| Best HMM Match : LRR_2 (HMM E-Value=0.34) 26 6.1 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 26 6.1 SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_21047| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) 26 6.1 SB_16692| Best HMM Match : UBA (HMM E-Value=1.8e-09) 26 6.1 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 26 8.1 SB_46284| Best HMM Match : RVT_1 (HMM E-Value=0.48) 26 8.1 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 26 8.1 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 26 8.1 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 26 8.1 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 26 8.1 SB_32874| Best HMM Match : Penaeidin (HMM E-Value=4.9) 26 8.1 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 26 8.1 SB_31772| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 26 8.1 SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 26 8.1 SB_21299| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 26 8.1 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 26 8.1 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 26 8.1 SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) 26 8.1 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 26 8.1 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 26 8.1 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 26 8.1 SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) 26 8.1 SB_51562| Best HMM Match : HARP (HMM E-Value=0.00049) 26 8.1 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 26 8.1 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 26 8.1 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 26 8.1 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_35754| Best HMM Match : DUF755 (HMM E-Value=2.4) 26 8.1 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 26 8.1 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 26 8.1 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 26 8.1 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 26 8.1 SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) 26 8.1 SB_24173| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) 26 8.1 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 26 8.1 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 >SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) Length = 969 Score = 44.8 bits (101), Expect = 2e-05 Identities = 25/59 (42%), Positives = 33/59 (55%) Frame = +1 Query: 145 PRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 P PTSP L+F + + + +DVHK+SGPD IP +LKT A EL P L + Sbjct: 642 PVLPTSPFPDIADLQFDTRGIA--KLLKSVDVHKASGPDQIPCWILKTAAEELAPFLQK 698 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 42.3 bits (95), Expect = 9e-05 Identities = 24/59 (40%), Positives = 32/59 (54%) Frame = +1 Query: 145 PRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 P P SP L+F + + + +DVHK+SGPD IP +LKT A EL P L + Sbjct: 498 PVLPISPFPDIADLQFDTRGIA--KLLKSVDVHKASGPDQIPCWILKTAAEELAPFLQK 554 >SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) Length = 805 Score = 42.3 bits (95), Expect = 9e-05 Identities = 24/59 (40%), Positives = 32/59 (54%) Frame = +1 Query: 145 PRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 P P SP L+F + + + +DVHK+SGPD IP +LKT A EL P L + Sbjct: 498 PVLPISPFPDIADLQFDTRGIA--KLLKSVDVHKASGPDQIPCWILKTAAEELAPFLQK 554 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 41.5 bits (93), Expect = 2e-04 Identities = 24/59 (40%), Positives = 32/59 (54%) Frame = +1 Query: 145 PRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 P PTS L+F + + + +DVHK+SGPD IP +LKT A EL P L + Sbjct: 867 PVLPTSSFPDIADLQFDTRGIA--KLLKSVDVHKASGPDQIPCWILKTAAEELAPFLQK 923 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 41.1 bits (92), Expect = 2e-04 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 +DVHK+SGPD IP +LKT A EL P L + Sbjct: 40 VDVHKASGPDQIPCWILKTAAEELAPFLQK 69 >SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) Length = 531 Score = 41.1 bits (92), Expect = 2e-04 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 +DVHK+SGPD IP +LKT A EL P L + Sbjct: 323 VDVHKASGPDQIPCWILKTAAEELAPFLQK 352 >SB_21018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 716 Score = 38.7 bits (86), Expect = 0.001 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +1 Query: 154 PTSPGVTAPCLRFASHSVRSD-RSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALT 318 PT P + P L S SV LD +K+ GPD +P +VLK CA EL P+++ Sbjct: 490 PTDPHI--PVLDSLSLSVEEVFEVLSGLDSNKAPGPDGLPTLVLKNCARELAPSIS 543 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 37.1 bits (82), Expect = 0.003 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +D K+ GPD IP+ VLK CA EL P+L Sbjct: 519 VDPRKARGPDNIPSAVLKICANELAPSL 546 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 37.1 bits (82), Expect = 0.003 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +D K+ GPD IP+ VLK CA EL P+L Sbjct: 111 VDPRKARGPDNIPSAVLKICANELAPSL 138 >SB_50830| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 273 Score = 35.5 bits (78), Expect = 0.010 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LDV K++GPD I A +LK APE+ P+L + Sbjct: 61 LDVTKATGPDGISARLLKETAPEIAPSLCK 90 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 99 VDKACGPDAVPARVLKEAATELAPILT 125 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 611 VDKACGPDAVPARVLKEAATELAPILT 637 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 9 VDKACGPDAVPARVLKEAATELAPILT 35 >SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) Length = 895 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 660 VDKACGPDAVPARVLKEAATELAPILT 686 >SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) Length = 748 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 573 VDKACGPDAVPARVLKEAATELAPILT 599 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 100 VDKACGPDAVPARVLKEAATELAPILT 126 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 8 VDKACGPDAVPARVLKEAATELAPILT 34 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 35.1 bits (77), Expect = 0.013 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALT 318 V K+ GPD +PA VLK A EL P LT Sbjct: 543 VDKACGPDAVPARVLKEAATELAPILT 569 >SB_2306| Best HMM Match : MecA_N (HMM E-Value=2.3) Length = 262 Score = 35.1 bits (77), Expect = 0.013 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +D K+ GPD IP+ V K CA EL P+L Sbjct: 135 VDPRKARGPDNIPSAVQKICADELAPSL 162 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 34.3 bits (75), Expect = 0.023 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD HK+ G D IP ++LK A ++TP+L Sbjct: 459 LDSHKACGTDQIPGILLKNTAHQITPSL 486 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 34.3 bits (75), Expect = 0.023 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +D K+ G D IP+ VLK CA EL P+L Sbjct: 102 VDPRKARGTDNIPSAVLKICADELAPSL 129 >SB_25036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 33.9 bits (74), Expect = 0.030 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 L V KSSGPD +P+V+ K APEL+ Sbjct: 57 LKVKKSSGPDPVPSVIWKEFAPELS 81 >SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) Length = 715 Score = 33.9 bits (74), Expect = 0.030 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD HK+ G D IP ++LK A ++ P+L R Sbjct: 433 LDSHKACGTDQIPGILLKNTAHQIAPSLCR 462 >SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 33.9 bits (74), Expect = 0.030 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD HK+ G D IP ++LK A ++ P+L R Sbjct: 427 LDPHKACGTDQIPGILLKNTAHQIAPSLCR 456 >SB_44362| Best HMM Match : Transposase_24 (HMM E-Value=6.3) Length = 306 Score = 33.5 bits (73), Expect = 0.040 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD HK+ G D IP ++LK A ++ P+L R Sbjct: 214 LDSHKACGTDQIPGILLKNTAYQIAPSLCR 243 >SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) Length = 1134 Score = 33.5 bits (73), Expect = 0.040 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 + DS+ S K+KA+ L K F S T D+G + + C +S+ +I TQ V ++L Sbjct: 888 RQGDSMYISDKDKAEALNKYFESVFTQDNGASPHLGPTTC-TSIQDIIFTQAGVHKQL 944 >SB_20796| Best HMM Match : RVT_1 (HMM E-Value=0.047) Length = 660 Score = 33.5 bits (73), Expect = 0.040 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 LDV+K+SG D IP +LK A ++ P+LT Sbjct: 418 LDVNKASGSDGIPCRLLKETAQQIAPSLT 446 >SB_44245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 404 Score = 33.1 bits (72), Expect = 0.053 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 + V KSSGPD +P+V+ K APEL+ Sbjct: 97 IKVKKSSGPDPVPSVIWKEFAPELS 121 >SB_27819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 33.1 bits (72), Expect = 0.053 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 + V KSSGPD +P+V+ K APEL+ Sbjct: 222 IKVKKSSGPDPVPSVIWKEFAPELS 246 >SB_26738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.1 bits (72), Expect = 0.053 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 + V KSSGPD +P+V+ K APEL+ Sbjct: 48 IKVKKSSGPDPVPSVIWKEFAPELS 72 >SB_7619| Best HMM Match : ArfGap (HMM E-Value=5.3) Length = 483 Score = 33.1 bits (72), Expect = 0.053 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 + V KSSGPD +P+V+ K APEL+ Sbjct: 177 IKVKKSSGPDPVPSVIWKEFAPELS 201 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 33.1 bits (72), Expect = 0.053 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = +3 Query: 45 LRKSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 LR+ N S+ S K+KA+ L K F S T+DDG + C + +I ITQ V ++L Sbjct: 1512 LRQGN-SMFISDKDKAEALNKYFESVFTMDDGVVPDLDPPTC-PKISDITITQAGVFKQL 1569 >SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 710 Score = 33.1 bits (72), Expect = 0.053 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 + V KSSGPD +P+V+ K APEL+ Sbjct: 310 IKVKKSSGPDPVPSVIWKEFAPELS 334 >SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) Length = 329 Score = 33.1 bits (72), Expect = 0.053 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = +3 Query: 45 LRKSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 LR+ N S+ S K+KA+ L K F S T+DDG + C + +I ITQ V ++L Sbjct: 95 LRQGN-SMFISDKDKAEALNKYFESVFTIDDGVVPDLDPPTC-PKISDITITQAGVFKQL 152 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 32.7 bits (71), Expect = 0.070 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPALT 318 +K++GPD IP +L+ A E+ PALT Sbjct: 13 NKANGPDLIPCKILQEAANEIAPALT 38 >SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) Length = 623 Score = 32.3 bits (70), Expect = 0.093 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPALT 318 K++GPD IP +L+ A E+ PALT Sbjct: 498 KANGPDLIPCKILQEAAHEIAPALT 522 >SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 32.3 bits (70), Expect = 0.093 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPALT 318 K++GPD IP +L+ A E+ PALT Sbjct: 613 KANGPDLIPCKILQEAAHEIAPALT 637 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 32.3 bits (70), Expect = 0.093 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPALT 318 K++GPD IP +L+ A E+ PALT Sbjct: 217 KANGPDLIPCKILQEAAHEIAPALT 241 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 31.9 bits (69), Expect = 0.12 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDG 140 +SND ++ S ++KA +L K F S T+DDG Sbjct: 342 RSNDGISISPRDKAQVLNKQFQSVFTVDDG 371 >SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 31.9 bits (69), Expect = 0.12 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LDV K++GP+ I +LK APE+ P+L + Sbjct: 141 LDVTKATGPNGISTRLLKETAPEIAPSLCK 170 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 31.9 bits (69), Expect = 0.12 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDG 140 +SND ++ S ++KA +L K F S T+DDG Sbjct: 1732 RSNDGISISPRDKAQVLNKQFQSVFTVDDG 1761 >SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 31.9 bits (69), Expect = 0.12 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 LDV+++SG D IP +LK A ++ P+LT Sbjct: 432 LDVNEASGSDGIPCRLLKETAQQIAPSLT 460 >SB_15909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.5 bits (68), Expect = 0.16 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 69 LDSNKAGGPDKLPTRILKELSQELAPLYTK 98 >SB_2139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 31.5 bits (68), Expect = 0.16 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDG 140 +SND ++ S ++KA +L K F S T+DDG Sbjct: 128 RSNDGVSISPRDKAQVLNKQFQSVFTVDDG 157 >SB_34486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 31.5 bits (68), Expect = 0.16 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDG 140 +SND ++ S ++KA +L K F S T+DDG Sbjct: 70 RSNDGVSISPRDKAQVLNKQFQSVFTVDDG 99 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 31.5 bits (68), Expect = 0.16 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDG 140 +SND ++ S ++KA +L K F S T+DDG Sbjct: 52 RSNDGVSISPRDKAQVLNKQFQSVFTVDDG 81 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 31.5 bits (68), Expect = 0.16 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 217 RSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + F LD K+SGPD IP +LK A + P+L Sbjct: 470 KRFWGLDASKASGPDNIPVRLLKETAAVIAPSL 502 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 31.5 bits (68), Expect = 0.16 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDG 140 +SND ++ S ++KA +L K F S T+DDG Sbjct: 81 RSNDGVSISPRDKAQVLNKQFQSVFTVDDG 110 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 69 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 98 >SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1786 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 229 FLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 ++ K+SGPD +P V+LK A +L PA+ Sbjct: 270 YIKTKKASGPDNLPNVILKIVAFKLAPAV 298 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 31.1 bits (67), Expect = 0.21 Identities = 22/60 (36%), Positives = 32/60 (53%) Frame = +3 Query: 45 LRKSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 LR+ N S+ S K+KA+ L K F S T+DDG + C + + ITQ V ++L Sbjct: 113 LRQGN-SMFISDKDKAEALNKYFESVFTMDDGVVPDLDPPTC-PKISDTTITQAGVFKQL 170 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 69 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 98 >SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) Length = 373 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 198 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 227 >SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) Length = 465 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 346 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 375 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 644 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 673 >SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 696 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 648 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 677 >SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 822 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 648 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 677 >SB_19445| Best HMM Match : DUF104 (HMM E-Value=7.3) Length = 246 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 198 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 227 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 172 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 201 >SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) Length = 723 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 273 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 302 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 630 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 659 >SB_49847| Best HMM Match : VAR1 (HMM E-Value=5.2) Length = 254 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 198 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 227 >SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 811 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 172 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 201 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 1795 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 1824 >SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) Length = 838 Score = 31.1 bits (67), Expect = 0.21 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +1 Query: 133 MTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPA 312 +T P SP L F+++ + + + +K+SGPD +PA +L A EL P Sbjct: 129 LTNIPVLGDSPYQEVADLTFSTNGIH--KQLKNIQPNKASGPDSVPARILIEAAGELAPL 186 Query: 313 L 315 L Sbjct: 187 L 187 >SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) Length = 435 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 69 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 98 >SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) Length = 242 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD +P +LK + EL P T+ Sbjct: 69 LDSNKAGGPDKLPTRILKELSQELAPLYTQ 98 >SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1251 Score = 30.7 bits (66), Expect = 0.28 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 178 PCLRFASHSVRS-DRSFGFLDVHKSSGPDCIPAVVLKTCAPEL 303 PC+ SV ++ ++ K++GPD IP+ VL+ CA E+ Sbjct: 624 PCMSNLQFSVNGIEKLLSKVNPSKANGPDMIPSRVLQECAHEV 666 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +3 Query: 54 SNDSLAHSAKEKADLLVKLFASYSTLDDG 140 SND ++ S ++KA +L K F S T+DDG Sbjct: 2 SNDGVSISPRDKAQVLNKQFQSVFTVDDG 30 >SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) Length = 798 Score = 30.7 bits (66), Expect = 0.28 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 190 FASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 F S + +S + +K+ GPD IPA++LK A EL+P Sbjct: 565 FLVSSYEAYKSMRGILTNKAPGPDGIPALILKMFAFELSP 604 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 30.7 bits (66), Expect = 0.28 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 178 PCLRFASHSVRS-DRSFGFLDVHKSSGPDCIPAVVLKTCAPEL 303 PC+ SV ++ ++ K++GPD IP+ VL+ CA E+ Sbjct: 158 PCMSNLQFSVNGIEKLLSKVNPSKANGPDMIPSRVLQECAHEV 200 >SB_21205| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.75) Length = 505 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD K+SGPD IP +LK A + P+L Sbjct: 423 LDASKASGPDNIPVRLLKETAAVIAPSL 450 >SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4) Length = 217 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD K+SGPD IP +LK A + P+L Sbjct: 77 LDASKASGPDNIPVRLLKETAAVIAPSL 104 >SB_58944| Best HMM Match : fn3 (HMM E-Value=0.88) Length = 697 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD K+SGPD IP +LK A + P+L Sbjct: 275 LDASKASGPDNIPVRLLKETAAVIAPSL 302 >SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD K+SGPD IP +LK A + P+L Sbjct: 1392 LDASKASGPDNIPVRLLKETAAVIAPSL 1419 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 30.7 bits (66), Expect = 0.28 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 214 DRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +R+ + K+ GPD IP +LKT + EL P + Sbjct: 173 ERALSATKIKKAPGPDGIPNTILKTFSFELAPVI 206 >SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 736 Score = 30.7 bits (66), Expect = 0.28 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + K+ GPD IP ++LKT + EL P + Sbjct: 472 IKLRKAGGPDGIPNIILKTFSFELAPVI 499 >SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 30.7 bits (66), Expect = 0.28 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + K+ GPD IP ++LKT + EL P + Sbjct: 558 IKLRKAGGPDGIPNIILKTFSFELAPVI 585 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD K+SGPD IP +LK A + P+L Sbjct: 430 LDASKASGPDNIPVRLLKETAAVIAPSL 457 >SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) Length = 359 Score = 30.7 bits (66), Expect = 0.28 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + K+ GPD IP ++LKT + EL P + Sbjct: 323 IKLRKAGGPDGIPNIILKTFSFELAPVI 350 >SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) Length = 692 Score = 30.7 bits (66), Expect = 0.28 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 208 RSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 R+ ++ + +KSSGPD IPA + T A EL P + Sbjct: 224 RAYQALRHVKTNKSSGPDPIPARIWNTFAIELAPVV 259 >SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) Length = 831 Score = 30.7 bits (66), Expect = 0.28 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 214 DRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +R+ + K+ GPD IP +LKT + EL P + Sbjct: 56 ERALSATKIKKAPGPDGIPNTILKTFSFELAPVI 89 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD K+SGPD IP +LK A + P+L Sbjct: 378 LDASKASGPDNIPVRLLKETAAVIAPSL 405 >SB_18313| Best HMM Match : Trans_reg_C (HMM E-Value=0.91) Length = 567 Score = 30.7 bits (66), Expect = 0.28 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 190 FASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 F S + +S + +K+ GPD IPA++LK A EL+P Sbjct: 308 FLVSSYETYKSLRGILTNKAPGPDGIPALILKMFAFELSP 347 >SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) Length = 867 Score = 30.7 bits (66), Expect = 0.28 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + K+ GPD IP ++LKT + EL P + Sbjct: 558 IKLRKAGGPDGIPNIILKTFSFELAPVI 585 >SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) Length = 560 Score = 30.7 bits (66), Expect = 0.28 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPALT 318 K++GPD IP +L+ E+ PALT Sbjct: 428 KANGPDLIPCKILQEAGHEIAPALT 452 >SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 30.3 bits (65), Expect = 0.38 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 + + SSGPD IP+V+ K APEL+ Sbjct: 653 IKLKNSSGPDPIPSVIWKEFAPELS 677 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 30.3 bits (65), Expect = 0.38 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = +3 Query: 63 SLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 S A K+KA+ L K F S T+DDG + C + +I ITQ V ++L Sbjct: 545 SKALKNKDKAEALNKYFESVFTMDDGVVPDLDPPTC-PKISDITITQAGVFKQL 597 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 30.3 bits (65), Expect = 0.38 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 ++ KS GPD IP ++LKT A EL+ ++ Sbjct: 90 INTRKSVGPDGIPNIILKTFAFELSTVIS 118 >SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049) Length = 588 Score = 30.3 bits (65), Expect = 0.38 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 214 DRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +R+ + K+ GPD IP +LKT A +L P + Sbjct: 230 ERALSATKIKKAPGPDGIPNTILKTFAFKLAPVI 263 >SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) Length = 832 Score = 30.3 bits (65), Expect = 0.38 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 +D +K+ GPD +P +LK + EL P T+ Sbjct: 388 IDSNKAGGPDKLPTRILKELSQELAPLYTQ 417 >SB_23376| Best HMM Match : GPS (HMM E-Value=1.2) Length = 368 Score = 30.3 bits (65), Expect = 0.38 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 214 DRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +R+ + K GPD IP +LKT + EL P + Sbjct: 169 ERALSATKIKKEPGPDGIPNTILKTFSFELAPVI 202 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 30.3 bits (65), Expect = 0.38 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 ++ KS GPD IP ++LKT A EL+ ++ Sbjct: 25 INTRKSVGPDGIPNIILKTFAFELSTVIS 53 >SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 575 NKSSGPDPIPARIWNTFAIELAPVV 599 >SB_50266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 115 NKSSGPDPIPARIWNTFAIELAPVV 139 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 704 NKSSGPDPIPARIWNTFAIELAPVV 728 >SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 559 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 163 NKSSGPDPIPARIWNTFAIELAPVV 187 >SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) Length = 347 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+V K++GPD +PA VL+ + E++ LT Sbjct: 152 LNVSKATGPDGLPARVLRDLSTEISDMLT 180 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/58 (31%), Positives = 33/58 (56%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 +S+DS+ S K+KA++L + F + T D+ G P +++ +I T VR++L Sbjct: 93 RSDDSIHVSPKDKAEVLNQRFQNAFTRDN-GCIPDLGQPLFAAINDITFTVPGVRKQL 149 >SB_31795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1525 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 514 NKSSGPDPIPARIWSTFAIELAPVV 538 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+V K++GPD +PA VL+ + E++ LT Sbjct: 872 LNVSKATGPDGLPARVLRDLSTEISDMLT 900 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+V K++GPD +PA VL+ + E++ LT Sbjct: 394 LNVSKATGPDGLPARVLRDLSTEISDMLT 422 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/58 (31%), Positives = 33/58 (56%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 +S+DS+ S K+KA++L + F + T D+ G P +++ +I T VR++L Sbjct: 335 RSDDSIHVSPKDKAEVLNQRFQNAFTRDN-GCIPDLGQPLFAAINDITFTVPGVRKQL 391 >SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 554 NKSSGPDPIPARIWNTFAIELAPVV 578 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 44 NKSSGPDPIPARIWNTFAIELAPVV 68 >SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 221 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+V K++GPD +PA VL+ + E++ LT Sbjct: 57 LNVSKATGPDGLPARVLRDLSTEISDMLT 85 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTP 309 +K+ GPD IPA++LK A EL+P Sbjct: 74 NKAPGPDGIPALILKMFAFELSP 96 >SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+ K+SGPD IP VL CA L ++T Sbjct: 617 LNPRKASGPDGIPGWVLNECADLLATSMT 645 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+V K++GPD +PA VL+ + E++ LT Sbjct: 646 LNVSKATGPDGLPARVLRDLSTEISDMLT 674 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/58 (31%), Positives = 33/58 (56%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 +S+DS+ S K+KA++L + F + T D+ G P +++ +I T VR++L Sbjct: 587 RSDDSIHVSPKDKAEVLNQRFQNAFTRDN-GCIPDLGQPLFAAINDITFTVPGVRKQL 643 >SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+V K++GPD +PA VL+ + E++ LT Sbjct: 594 LNVSKATGPDGLPARVLRDLSTEISDMLT 622 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/58 (31%), Positives = 33/58 (56%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 +S+DS+ S K+KA++L + F + T D+ G P +++ +I T VR++L Sbjct: 535 RSDDSIHVSPKDKAEVLNQRFQNAFTRDN-GCIPDLGQPLFAAINDITFTVPGVRKQL 591 >SB_39518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 LD HK+ G D IP ++LK A PAL Sbjct: 52 LDSHKACGTDQIPGILLKNTALGSVPAL 79 >SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 62 NKSSGPDPIPARIWNTFAIELAPVV 86 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 154 NKSSGPDPIPARIWNTFAIELAPVV 178 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 29.9 bits (64), Expect = 0.50 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +3 Query: 81 KEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 K+KA+ L K F S T+DDG + C + +I ITQ V ++L Sbjct: 961 KDKAEALNKYFESVFTMDDGVVPDLDPPTC-PKISDITITQAGVFKQL 1007 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+V K++GPD +PA VL+ + E++ LT Sbjct: 730 LNVSKATGPDGLPARVLRDLSTEISDMLT 758 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/58 (31%), Positives = 33/58 (56%) Frame = +3 Query: 51 KSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQEL 224 +S+DS+ S K+KA++L + F + T D+ G P +++ +I T VR++L Sbjct: 671 RSDDSIHVSPKDKAEVLNQRFQNAFTRDN-GCIPDLGQPLFAAINDITFTVPGVRKQL 727 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +KSSGPD IPA + T A EL P + Sbjct: 271 NKSSGPDPIPARIWNTFAIELAPVV 295 >SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) Length = 317 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 217 RSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALT 318 + F L+ K++GPD P +LK A L PA+T Sbjct: 108 KKFSLLNTTKATGPDGFPGWLLKENADLLEPAVT 141 >SB_53821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 29.5 bits (63), Expect = 0.66 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 133 MTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 +T P SP + F++ ++ + + K+ GPD IPA +LK A EL P Sbjct: 158 LTNVPVLDGSPFPDVTDIIFSAAGIQ--KQLQLIQTDKACGPDSIPARLLKEAACELAP 214 >SB_46086| Best HMM Match : RVT_1 (HMM E-Value=1.6e-20) Length = 723 Score = 29.5 bits (63), Expect = 0.66 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPAL 315 K+ GPD IP +LKT A EL P + Sbjct: 383 KAPGPDGIPNTILKTFAFELAPVI 406 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 29.5 bits (63), Expect = 0.66 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 235 DVHKSSGPDCIPAVVLKTCAPELTPALT 318 + KS GPD IP ++LKT A EL+ ++ Sbjct: 410 NTRKSVGPDGIPNIILKTFAFELSTVIS 437 >SB_21517| Best HMM Match : UCR_UQCRX_QCR9 (HMM E-Value=7.2) Length = 194 Score = 29.5 bits (63), Expect = 0.66 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 133 MTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 +T P SP + F++ ++ + + K+ GPD IPA +LK A EL P Sbjct: 83 LTNVPVLDGSPFPDVTDIIFSTAGIQ--KQLQLIQTDKACGPDSIPARLLKEAACELAP 139 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 29.5 bits (63), Expect = 0.66 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LDV+K+ G + IP +LK A ++ P+LT+ Sbjct: 1507 LDVNKALGSNGIPCRLLKETAQQIAPSLTQ 1536 >SB_55982| Best HMM Match : Transposase_11 (HMM E-Value=2.3) Length = 513 Score = 29.5 bits (63), Expect = 0.66 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +1 Query: 145 PRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 P P S G + R AS + ++ G L G D +PA +++ A ++TP LT+ Sbjct: 76 PGAPRSVGALSADRRRASVRLWTEHGLGRL-ADAERGGDSVPATPVESTASDITPLLTQ 133 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 29.5 bits (63), Expect = 0.66 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 133 MTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 +T P SP + F++ ++ + + K+ GPD IPA +LK A EL P Sbjct: 1464 LTNVPVLDGSPFPDVTDIIFSAAGIQ--KQLQLIQTDKACGPDSIPARLLKEAACELAP 1520 >SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031) Length = 753 Score = 29.5 bits (63), Expect = 0.66 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 133 MTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 +T P SP + F++ ++ + + K+ GPD IPA +LK A EL P Sbjct: 642 LTNVPVLDGSPFPDVTDIIFSAAGIQ--KQLQLIQTDKACGPDSIPARLLKEAACELAP 698 >SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 29.5 bits (63), Expect = 0.66 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 235 DVHKSSGPDCIPAVVLKTCAPELTPALT 318 + KS GPD IP ++LKT A EL+ ++ Sbjct: 448 NTRKSVGPDGIPNIILKTFAFELSTVIS 475 >SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 750 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 + V K+ GPD +P ++LK A EL P ++ Sbjct: 307 IKVKKAPGPDGLPNIILKEFAHELGPVVS 335 >SB_19870| Best HMM Match : RVT_1 (HMM E-Value=0.18) Length = 530 Score = 29.1 bits (62), Expect = 0.87 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 27 GLAFHXLRKSNDSLAHSAKEKADLLVKLFASYSTLDDGGATPPNISRCDSSMPEIRITQR 206 G + L+ + SLA S EKA +L + F + ++ + P RC M +IR+TQ Sbjct: 36 GQSMPPLKSHDHSLAKSDTEKATVLNQHFCLNFSSENTNSIPHLQRRC-PKMTDIRVTQG 94 Query: 207 AV 212 V Sbjct: 95 GV 96 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTP 309 + K+ GPD IP +VLK A EL P Sbjct: 503 IKKAPGPDGIPNIVLKVFAFELAP 526 >SB_14210| Best HMM Match : RVT_1 (HMM E-Value=0.2) Length = 712 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 + V K+ GPD +P ++LK A EL P ++ Sbjct: 303 IKVKKAPGPDGLPNIILKEFAHELGPVVS 331 >SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6) Length = 509 Score = 29.1 bits (62), Expect = 0.87 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = +1 Query: 133 MTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPA 312 +T P SP L F ++ + + + +K+SGPD +PA L A EL P Sbjct: 330 LTNIPVLGDSPYQEVADLTFTTNGIH--KQLKNIQPNKASGPDSVPARFLIEAAGELAPL 387 Query: 313 L 315 L Sbjct: 388 L 388 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTP 309 + K+ GPD IP +VLK A EL P Sbjct: 3816 IKKAPGPDGIPNIVLKVFAFELAP 3839 >SB_24103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPAL 315 K++GPD VLK CAP ++P L Sbjct: 69 KAAGPDSFHPRVLKECAPVISPIL 92 >SB_20248| Best HMM Match : GPS (HMM E-Value=1.5) Length = 555 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPAL 315 + K+ GPD IP +LKT + EL P + Sbjct: 430 IKKAPGPDGIPNTILKTFSFELAPVI 455 >SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) Length = 445 Score = 29.1 bits (62), Expect = 0.87 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = +1 Query: 133 MTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPA 312 +T P SP L F ++ + + L +K+S PD +PA +L A EL P Sbjct: 296 LTNIPVLGDSPYQEVADLTFTTNGIH--KQLKNLQPNKASSPDSVPARILIEAAGELAPL 353 Query: 313 L 315 L Sbjct: 354 L 354 >SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 + V K+ GPD +P ++LK A EL P ++ Sbjct: 699 IKVKKAPGPDGLPNIILKEFAHELGPVVS 727 >SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) Length = 884 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 + V K+ GPD +P ++LK A EL P ++ Sbjct: 559 IKVKKAPGPDGLPNIILKEFAHELGPVVS 587 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 L+V KSSGPD I VL+ A EL+ L Sbjct: 803 LNVSKSSGPDGISPRVLRDLAKELSGML 830 >SB_4166| Best HMM Match : RVT_1 (HMM E-Value=0.00088) Length = 271 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTP 309 + K+ GPD IP +VLK A EL P Sbjct: 20 IKKAPGPDGIPNIVLKVFAFELAP 43 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 214 DRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPA 312 +R+ + K++ PD IP +LKT + EL P+ Sbjct: 298 ERALSATKIKKATDPDGIPNTILKTFSFELAPS 330 >SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4994 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 241 HKSSGPDCIPAVVLKTCAPELTPAL 315 +K+SGPD +PA +L EL P L Sbjct: 2725 NKASGPDSVPARILIEAGGELAPLL 2749 >SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 447 Score = 28.3 bits (60), Expect = 1.5 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L+ K++GPD +P +LK A L PA+T Sbjct: 163 LNTTKATGPDGVPGWLLKENADLLVPAVT 191 >SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPAL 315 K++GPD VLK CAP ++P L Sbjct: 18 KAAGPDGFHPRVLKECAPVISPIL 41 >SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) Length = 523 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 + V K+ GPD P ++LK A EL P ++ Sbjct: 58 IKVKKAPGPDGFPNIILKEFAHELGPVVS 86 >SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 554 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCA 294 L+V+K+ GPD IPA +L CA Sbjct: 424 LNVNKAMGPDLIPARLLVECA 444 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 ++ KS GP+ IP ++LKT A EL+ ++ Sbjct: 461 INTRKSVGPNRIPNIILKTFAFELSTVIS 489 >SB_50175| Best HMM Match : fn3 (HMM E-Value=1.3e-12) Length = 160 Score = 27.9 bits (59), Expect = 2.0 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +3 Query: 114 ASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQELRFS*CP*VEWARLHP 269 A+Y+ + DG A+P I+R D +P ++ R + R S V+W + P Sbjct: 40 AAYTRMGDGPASPEVIARTDEGVP--AVSPDVTRADNRSSTSILVQWRPVPP 89 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 27.9 bits (59), Expect = 2.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALTR 321 VHK++GPD + +VL+ A + P L + Sbjct: 393 VHKAAGPDGLSPMVLRELASVIAPVLQK 420 >SB_40727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.9 bits (59), Expect = 2.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELT 306 LD K+ GPD IP ++K A E+T Sbjct: 156 LDSKKARGPDEIPTKIIKETAAEIT 180 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 27.9 bits (59), Expect = 2.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 L KS+GPD + +LK A +TP LT Sbjct: 620 LKTSKSAGPDRLHPKILKEVATTITPMLT 648 >SB_23048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 205 VRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 VRS ++ + + SGPD IP+ + K A EL P + Sbjct: 34 VRSPKALCSIKAKRPSGPDPIPSRLWKEFAYELAPVV 70 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 27.9 bits (59), Expect = 2.0 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 145 PRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSGPDCIP 270 P P SP L+F + + + +DVHK+SGPD IP Sbjct: 65 PVLPISPFPDIADLQFDTRGIA--KLLKSVDVHKASGPDQIP 104 >SB_58776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 229 FLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 FL S GPD IP +VLK A EL P + Sbjct: 23 FLCGRFSLGPDDIPNIVLKEFAFELAPII 51 >SB_27920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/68 (22%), Positives = 29/68 (42%) Frame = -2 Query: 310 RVSTQGRMFLEPLRGCNLAHSTYGHQENRSSCLTARCVMRISGMELSHREMLGGVAPPSS 131 R+S + +MF+ + C + H+E L ++ + + L M G P+S Sbjct: 178 RLSPEKKMFIHQIELCGAVLNNGSHEERNPKILISKAYGKSVMISLDFLNMSGQFTNPTS 237 Query: 130 KVEYEAKS 107 K + +S Sbjct: 238 KWNFLKES 245 >SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 27.5 bits (58), Expect = 2.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 190 FASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 F S + +S + +K+ GPD IPA++ K EL+P Sbjct: 432 FLVSSYEAYKSLRGILANKAPGPDGIPALIFKMFTFELSP 471 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 214 DRSFGFLDVHKSSGPDCIPAVVLKTCAPELTPAL 315 +R+ + K+ GPD I +LKT + EL P + Sbjct: 40 ERALSATKIKKAPGPDGISNTILKTFSFELAPVI 73 >SB_15616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 190 FASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 F S + +S + +K+ G D IPA++LK A EL+P Sbjct: 82 FLVSSYEAYKSLRGILTNKAPGQDGIPALILKMFAFELSP 121 >SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 L K+ G D I A +L+ AP++ P+LT+ Sbjct: 43 LQTCKAKGLDGISARLLRAAAPDIAPSLTK 72 >SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1808 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + K+ GPD IP VLK A EL P + Sbjct: 1346 IQLRKAPGPDDIPNKVLKEFAFELAPII 1373 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 45 LRKSNDSLAHSAKEKADLLVKL 110 L K+N+ LA+ K K DLLVK+ Sbjct: 68 LEKNNERLANEVKSKNDLLVKV 89 >SB_40921| Best HMM Match : Choline_kin_N (HMM E-Value=2.8) Length = 351 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 100 WSSSLPHTRLWMTEEPRRPTSPGVTAPCLRFASHSVRS 213 WS +P +T+ P +PT TAP L +H +S Sbjct: 285 WSYQMPRIIKCVTQLPPKPTPYNWTAPTLTVPAHRKQS 322 >SB_21914| Best HMM Match : Exo_endo_phos (HMM E-Value=6e-05) Length = 502 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 190 FASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 F S + +S + +K+ G D IPA++LK A EL+P Sbjct: 325 FLVSSYEAYKSLRGILTNKAPGQDGIPALILKMFAFELSP 364 >SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 898 Score = 27.1 bits (57), Expect = 3.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPEL 303 + KS+GPD +P V+LK A EL Sbjct: 445 VQARKSAGPDGVPNVILKEFAFEL 468 >SB_50373| Best HMM Match : HC2 (HMM E-Value=0.001) Length = 382 Score = 27.1 bits (57), Expect = 3.5 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 LD K++G D IP+ +LK + ++P+LT Sbjct: 308 LDAGKATGLDKIPSKLLKLASKIISPSLT 336 >SB_23637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 27.1 bits (57), Expect = 3.5 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = +1 Query: 82 RRRLTFWSSSLPHTRLWMTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSG 255 RRR + SS T +WM ++ +RP + T P + +H+ +G + + +G Sbjct: 30 RRRASQHSSPQSQTVVWMKKKEKRPLAWDRTRPGKQNGNHTYGLPNRYGSTRLLRKAG 87 >SB_16024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 3.5 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = +1 Query: 82 RRRLTFWSSSLPHTRLWMTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSG 255 RRR + SS T +WM ++ +RP + T P + +H+ +G + + +G Sbjct: 59 RRRASQHSSPQSQTVVWMKKKEKRPLAWDRTRPGKQNGNHTYGLPNRYGSTRLLRKAG 116 >SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) Length = 547 Score = 27.1 bits (57), Expect = 3.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD + +LK + EL P T+ Sbjct: 388 LDSNKAGGPDKLLTRILKELSQELAPLYTQ 417 >SB_7671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 27.1 bits (57), Expect = 3.5 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = +1 Query: 82 RRRLTFWSSSLPHTRLWMTEEPRRPTSPGVTAPCLRFASHSVRSDRSFGFLDVHKSSG 255 RRR + SS T +WM ++ +RP + T P + +H+ +G + + +G Sbjct: 30 RRRASQHSSPQSQTVVWMKKKEKRPLAWDRTRPGKQNGNHTYGLPNRYGSTRLLRKAG 87 >SB_46645| Best HMM Match : Exo_endo_phos (HMM E-Value=0.044) Length = 464 Score = 27.1 bits (57), Expect = 3.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPAL 315 KSSGPD IP+ + K A EL P + Sbjct: 395 KSSGPDPIPSRLWKEFAYELAPVV 418 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 27.1 bits (57), Expect = 3.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD +K+ GPD + +LK + EL P T+ Sbjct: 627 LDSNKAGGPDKLLTRILKELSQELAPLYTQ 656 >SB_41660| Best HMM Match : PyrI_C (HMM E-Value=4.6) Length = 367 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALTR 321 + KS D +PA +LK C L P +TR Sbjct: 114 ISKSCNLDPLPASLLKECFSTLLPIITR 141 >SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALTR 321 + KS D +PA +LK C L P +TR Sbjct: 2215 ISKSCNLDPLPASLLKECFSTLLPIITR 2242 >SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) Length = 674 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALTR 321 LD+ K++G D + LK+ APE+ +LT+ Sbjct: 150 LDIGKAAGLDELNGFFLKSVAPEIFRSLTK 179 >SB_57036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPAL 315 +SSGPD IP+ +L+ A EL P + Sbjct: 159 RSSGPDPIPSRLLEEFAYELAPVV 182 >SB_43011| Best HMM Match : AgrD (HMM E-Value=3.4) Length = 241 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPEL 303 + K+ GPD IP +VLK A EL Sbjct: 140 IEKAPGPDGIPNIVLKVFAFEL 161 >SB_19955| Best HMM Match : AFP (HMM E-Value=0.14) Length = 691 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 235 DVHKSSGPDCIPAVVLKTCAPELTPALT 318 D+ + GPD P V T +P TP LT Sbjct: 58 DICEDDGPDLPPVVPPPTGSPSSTPGLT 85 >SB_12971| Best HMM Match : RBB1NT (HMM E-Value=4.1) Length = 190 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 292 RMFLEPLRGCNLAHSTYGHQENRSSCLT 209 R ++PL C +A+ Y H N SSC T Sbjct: 137 RSMIDPLPICIVANRYYSHLTNVSSCPT 164 >SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) Length = 504 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 217 RSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALT 318 ++ + K+ G D IPA + K C P LT Sbjct: 289 KAISLMSPGKAPGADAIPAEIYKACGPIAVNKLT 322 >SB_8909| Best HMM Match : LRR_2 (HMM E-Value=0.34) Length = 568 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALTR 321 + KS D +PA +LK C L P +TR Sbjct: 354 ISKSCNLDPLPASLLKGCFSTLLPIITR 381 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 26.2 bits (55), Expect = 6.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 190 FASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 F S + +S + +K+ GPD IPA +LK A L+P Sbjct: 437 FLVSSYEAYKSLRGILTNKAPGPDGIPARILKMFAFGLSP 476 >SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1283 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 236 SRKPK-LLSDRTLCDANLRHGAVTPGD 159 S+KPK LLS + L + L HG+ P D Sbjct: 614 SKKPKPLLSAKELSEIRLHHGSTEPVD 640 >SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 217 RSFGFLDVHKSSGPDCIPAVVLKTCAPELTPALT 318 ++ + K+ G D IPA + K C P LT Sbjct: 36 KAISLMSPGKAPGADAIPAEIYKACGPIAVNKLT 69 >SB_21047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALTR 321 + KS D +PA +LK C L P +TR Sbjct: 34 ISKSCNLDPLPASLLKGCFSTLLPIITR 61 >SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) Length = 376 Score = 26.2 bits (55), Expect = 6.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 190 FASHSVRSDRSFGFLDVHKSSGPDCIPAVVLKTCAPELTP 309 F S + +S + +K+ GPD IPA +LK A L+P Sbjct: 57 FLVSSYEAYKSLRGILTNKAPGPDGIPARILKMFAFGLSP 96 >SB_16692| Best HMM Match : UBA (HMM E-Value=1.8e-09) Length = 237 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 238 VHKSSGPDCIPAVVLKTCAPELTPALTR 321 + KS D +PA +LK C L P +TR Sbjct: 34 ISKSCNLDPLPASLLKGCFSTLLPIITR 61 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 71 TTYARQEKRLNTFHMRCLRRILGIHWSDK 99 >SB_46284| Best HMM Match : RVT_1 (HMM E-Value=0.48) Length = 549 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLK 285 L+ K+SGPD IPA +LK Sbjct: 235 LNAKKASGPDSIPAWLLK 252 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 39 TTYARQEKRLNTFHMRCLRRILGIHWSDK 67 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 511 TTYARQEKRLNTFHMRCLRRILGIHWSDK 539 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 589 TTYARQEKRLNTFHMRCLRRILGIHWSDK 617 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 39 TTYARQEKRLNTFHMRCLRRILGIHWSDK 67 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 343 TTYARQEKRLNTFHMRCLCRILGIHWSDK 371 >SB_32874| Best HMM Match : Penaeidin (HMM E-Value=4.9) Length = 192 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + KS GPD +P + K A EL+P + Sbjct: 29 IQIKKSPGPDPVPNRIWKEFAFELSPVV 56 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 551 TTYARQEKRLNTFHMRCLRRILGIHWSDK 579 >SB_31772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 223 SSCLTARCVMRISGMELSHREML-GGVAPPSSKVEY 119 ++CL ++SG+E++HR ++ GG SK+ Y Sbjct: 206 NACLGLTDKGKVSGLEMNHRVLVRGGTVETRSKLLY 241 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + KS GPD +P + K A EL+P + Sbjct: 83 IQIKKSPGPDPVPNRIWKEFAFELSPVV 110 >SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 1115 Score = 25.8 bits (54), Expect = 8.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 118 HTRLWMTEEPRRPTSPGVTAP 180 H RLW+ RR T +T+P Sbjct: 523 HVRLWLRSRQRRATPARITSP 543 >SB_21299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2630 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 114 ASYSTLDDGGATPPNISRCDSSMPEIRITQRAVRQELRFS*CP*VEWARLHP 269 A+Y+ + DG A+P I+ D +P ++ R + R S V+W + P Sbjct: 2022 AAYTRMGDGPASPEVIAHTDEGVP--AVSPDVTRADNRSSTSILVQWRPVPP 2071 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 120 TTYARQEKRLNTFHMRCLRRILGIHWSDK 148 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 119 TTYARQEKRLNTFHMRCLRRILGIHWSDK 147 >SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 192 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 5 TTYARQEKRLNTFHMRCLRRILGIHWSDK 33 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 25.8 bits (54), Expect = 8.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 130 WMTEEPRRPTSPGVTAP 180 WM+ P P SPG T+P Sbjct: 384 WMSPTPGSPVSPGPTSP 400 >SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) Length = 952 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPEL 303 + KSSGPD +P V+ K A EL Sbjct: 490 VQARKSSGPDGVPNVIRKEFAFEL 513 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 223 TTYARQEKRLNTFHMRCLCRILGIHWSDK 251 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 120 TTYARQEKRLNTFHMRCLRRILGIHWSDK 148 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 39 TTYARQEKRLNTFHMRCLRRILGIHWSDK 67 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 340 TTYARQEKRLNTFHMRCLRRILGIHWSDK 368 >SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 92 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 39 TTYARQEKRLNTFHMRCLRRILGIHWSDK 67 >SB_51562| Best HMM Match : HARP (HMM E-Value=0.00049) Length = 508 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 314 SAGVNSGAHVFRTTAGMQSGPLDLWTSRKPKLLS 213 S GV + + FR GP D + RKP S Sbjct: 257 SDGVENRQNAFRNKTDCDGGPRDFFAPRKPSQTS 290 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 39 TTYARQEKRLNTFHMRCLRRILGIHWSDK 67 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPALT 318 + V K++GPD + +VLK A EL P ++ Sbjct: 459 IKVKKATGPDGLHNIVLKEFAFELGPVVS 487 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 2431 TTYARQEKRLNTFHMRCLRRILGIHWSDK 2459 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 172 TTYARQEKRLNTFHMRCLRRILGIHWSDK 200 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 155 TTYARQEKRLNTFHMRCLRRILGIHWSDK 183 >SB_35754| Best HMM Match : DUF755 (HMM E-Value=2.4) Length = 604 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 154 PTSPGVTAPCLRFASHSVRSDRSFGFLDVHKS-SGPDCIPAVVL 282 P SPG+ A ++ R D+S F+ KS P P V L Sbjct: 253 PESPGIVKGTASSAGNTRREDKSLSFIKDRKSLESPLIFPQVKL 296 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 120 TTYARQEKRLNTFHMRCLRRILGIHWSDK 148 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 39 TTYARQEKRLNTFHMRCLRRILGIHWSDK 67 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 269 TTYARQEKRLNTFHMRCLRRILGIHWSDK 297 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 155 TTYARQEKRLNTFHMRCLRRILGIHWSDK 183 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 229 TTYARQEKRLNTFHMRCLRRILGIHWSDK 257 >SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) Length = 565 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 244 KSSGPDCIPAVVLKTCAPELTPALT 318 K+ G D IPA + K C P LT Sbjct: 5 KAPGADAIPAEIYKACGPIAVNKLT 29 >SB_24173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 58 MTVWLIVRRRRLTFWSSSLPHTRLWMT-EEPRRPTSPG 168 +T WL RRL WS RL+ + +RP SPG Sbjct: 12 LTTWLGPPNRRLVTWSRK-GSVRLYNSFSHRKRPVSPG 48 >SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 232 LDVHKSSGPDCIPAVVLKTCAPELTPAL 315 + + KS GPD +P + K A EL+P + Sbjct: 503 IQIKKSPGPDPVPNRIWKEFAFELSPVV 530 >SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) Length = 959 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 61 TVWLIVRRRRLTFWSSSLPHTRLWMTEEPRRPTSPGVTAPCLRFAS 198 +VW++ + R +P TR +T + SPG A LR S Sbjct: 316 SVWIVFKYREFYMDRVYIPVTRKQITSSDKGSRSPGKVAENLRSQS 361 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 172 TTYARQEKRLNTFHMRCLRRILGIHWSDK 200 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 250 STYGHQENRSSCLTARCVMRISGMELSHR 164 +TY QE R + RC+ RI G+ S + Sbjct: 39 TTYARQEKRLNTFHMRCLRRILGIHWSDK 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,779,447 Number of Sequences: 59808 Number of extensions: 210510 Number of successful extensions: 990 Number of sequences better than 10.0: 223 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 438034835 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -