BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0856 (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2... 29 0.49 SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccha... 26 4.5 SPAC664.09 |ggt1||gamma-glutamyltranspeptidase Ggt1 |Schizosacch... 26 4.5 SPBC337.16 |cho1||phosphatidyl-N-methylethanolamine N-methyltran... 25 6.0 SPBC1709.13c |||lysine methyltransferase |Schizosaccharomyces po... 25 6.0 SPAC2F7.14c |||exosome subunit Rrp4 |Schizosaccharomyces pombe|c... 25 6.0 SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||... 25 7.9 >SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 825 Score = 29.1 bits (62), Expect = 0.49 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = +1 Query: 418 PGISKLHFASQAS*FLRVLLKCLQCKSRAQIQIYSTKN 531 PG+S+++F A+ FL + +C++ ++ + + S+KN Sbjct: 580 PGVSRVYFPPDANCFLATVARCMKSENTINLMV-SSKN 616 >SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 535 Score = 25.8 bits (54), Expect = 4.5 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = +3 Query: 42 WPPPLHKKGGKVPKMKGRHFVYDLVEDTSVKKKPDIRIVLNQFVEGV 182 W P L V K G FVYD++ S K + + N E V Sbjct: 279 WKPVLETNRLLVGKGNGNIFVYDIIWSESTSKAVLVATITNAHDEQV 325 >SPAC664.09 |ggt1||gamma-glutamyltranspeptidase Ggt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 25.8 bits (54), Expect = 4.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 138 KPDIRIVLNQFVEGVGTTGDVLTLHLNKAYENFILPG 248 +P+ I+LN ++ + G V L+ + NFI PG Sbjct: 470 EPETGIILNDHMDDFASPGIVNAFGLSPSPYNFIAPG 506 >SPBC337.16 |cho1||phosphatidyl-N-methylethanolamine N-methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 221 Score = 25.4 bits (53), Expect = 6.0 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 102 VYDLVEDTSVKKKPDIRIVLNQFVEGV 182 V DL+ ++K++P + I +N V+G+ Sbjct: 87 VRDLIYQNALKQQPTLGIFMNPLVQGI 113 >SPBC1709.13c |||lysine methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 25.4 bits (53), Expect = 6.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 445 LRNEALRCQGCRVHGSELLIVTRSTNLCKQSIVLFTNGEL 326 L +EAL+ GC++H S I +R N C S + ++ Sbjct: 4 LLHEALQ-NGCKLHKSVEFIQSRDDNACFGSYIAVAQNDI 42 >SPAC2F7.14c |||exosome subunit Rrp4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 329 Score = 25.4 bits (53), Expect = 6.0 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = +3 Query: 108 DLVEDTSVKKKPDIRIVLNQFVEGVGTTGDVLTLHLNKAYENFILPGLAVYANPENLEKY 287 D+V D S+ + D ++ G+ DVL ++N + PG V +P+ + + Sbjct: 17 DIVNDVSMTEMEDE--IMEDEQMGLVDGEDVLEEFDKSIHQNLVTPGQLVTDDPQFMRGH 74 Query: 288 KTY 296 TY Sbjct: 75 GTY 77 >SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1315 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 339 QMESCEYFLLEDVFHRFYIFPNF 271 +++S L+++V H FYIF F Sbjct: 318 ELKSVSQLLIDEVLHPFYIFQVF 340 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,481,879 Number of Sequences: 5004 Number of extensions: 50840 Number of successful extensions: 134 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -