BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0852 (569 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium tra... 27 1.9 SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase Rqh1|... 27 2.6 >SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium transporting Cta4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1211 Score = 27.1 bits (57), Expect = 1.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 308 SQTLQYSTALSRNRFSYE 361 SQT+QYS + R RF YE Sbjct: 120 SQTIQYSFSFQRKRFIYE 137 >SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase Rqh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1328 Score = 26.6 bits (56), Expect = 2.6 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 224 YIVGSSNHIKHSVIGNKTEFIYFISKNASQTLQYSTALSRNRFSYE*RHLGLKST 388 Y+V I +SV+ K I + +++S+ S +LSR++ R LKST Sbjct: 1010 YVVPGRQTIINSVLAGKRRIILDVKESSSKPDTSSRSLSRSKTLPALREYQLKST 1064 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,033,999 Number of Sequences: 5004 Number of extensions: 35753 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -