BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0852 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 24 4.0 DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 23 7.0 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 7.0 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 23 9.3 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.8 bits (49), Expect = 4.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 247 YKAFCNRKQDRIYLFY 294 Y+ +C + DR+Y FY Sbjct: 766 YRPYCKGRADRLYEFY 781 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 484 H*SKNCKKFWQAKQESKASEVNHG 413 H + K WQ +QE S NHG Sbjct: 200 HDRSDYKHGWQMEQEGAGSGHNHG 223 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 356 YE*RHLGLKSTMTDHVQQSTMIYLRCFGLLFSLPKF 463 Y+ ++ L+ V TMI L CF +L+ + F Sbjct: 968 YQPDYMFLRQVPIRRVHLFTMIQLACFAVLWLIKSF 1003 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 484 H*SKNCKKFWQAKQESKASEVNHG 413 H + K WQ +QE S NHG Sbjct: 200 HDRSDYKHGWQMEQEGGGSGHNHG 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 511,264 Number of Sequences: 2352 Number of extensions: 8975 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -