BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0850 (592 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 27 0.45 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 27 0.45 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 27 0.45 X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 25 1.8 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 2.4 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 4.2 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 7.4 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 7.4 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 9.8 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 67 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 204 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 382 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 423 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 25.0 bits (52), Expect = 1.8 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = -2 Query: 123 DNFFFRMFRILVSVREEVGVERHCYTCRYGRVSNPRAE 10 D F R+F I ++++ + + CY ++ ++ N RA+ Sbjct: 134 DGFMLRVFCIGFTIKDSMSQRKTCY-AQHSQIKNIRAK 170 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.6 bits (51), Expect = 2.4 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +1 Query: 256 RDTLMKQKVAESVLQRVVGEEAPKVL---HKQFNSPINLYSEQNIANSIRQQTSPLPT 420 R T Q+ + + + + AP+V H Q N +LYS +N + R + P P+ Sbjct: 1072 RITSALQQDWDETRRELAEQGAPRVADNQHNQDNDRTSLYSARNTSEEQRGRRHPTPS 1129 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +2 Query: 377 TLQTLSGSKLRLCQLTAITDGRTLSRGKSFTRNATMQQST 496 T L G + R+C+ TDG R F +A ++T Sbjct: 293 TSTALDGQRTRVCKCMHFTDGPDCDRCLPFYNDAPWGRAT 332 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 7.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 159 PGS*GPKGAWPHRELPASSPQPSNEGT 239 PG G KGA R P S P +GT Sbjct: 108 PGPMGLKGAKGVRGFPGSEGLPGEKGT 134 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.0 bits (47), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 117 FFFRMFRILVSVREEVGVER 58 FF MFR V REE G+ R Sbjct: 252 FFTEMFRQSVQEREEHGIVR 271 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 22.6 bits (46), Expect = 9.8 Identities = 18/61 (29%), Positives = 22/61 (36%) Frame = +2 Query: 323 LRCCTSNSTLQSIYTRNRTLQTLSGSKLRLCQLTAITDGRTLSRGKSFTRNATMQQSTHI 502 L C S TL +I L+ G K LC +I T+ S T HI Sbjct: 167 LSICASVFTLMAIAIDMNPLKPRMGKKATLCVAASIWIVGTIISCPSLLFFTTYPMKDHI 226 Query: 503 L 505 L Sbjct: 227 L 227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,751 Number of Sequences: 2352 Number of extensions: 14393 Number of successful extensions: 47 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -