BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0850 (592 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 6.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 6.8 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 9.0 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 9.0 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 9.0 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 1 LQEFGTRVRYTSIPTSVTMSLNPNFF 78 +QE R+RY PTS + PN + Sbjct: 368 IQEQIPRLRYIGPPTSFPRFIPPNAY 393 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +1 Query: 28 YTSIPTSVTMSLNPNFFPNGYQDPKHPEEEVVSNWPYRTTPLV 156 YT+ P ++ LNPN P ++E++ ++ R +P + Sbjct: 210 YTACPPTLACPLNPN------PQPLTGQQELLQDFSKRFSPAI 246 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +2 Query: 302 EWLAKRHLRCCTSNSTLQSIYTRNRTLQTLSGSKLRLCQL 421 +W++ + + L +TL T +GS L +C L Sbjct: 80 KWISPGDTKVMVEHGELVMGILCKKTLGTSAGSLLHICML 119 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 Query: 87 SVREEVGVERHCYTCR 40 SV G + CY CR Sbjct: 80 SVASTTGFSKECYCCR 95 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 Query: 87 SVREEVGVERHCYTCR 40 SV G + CY CR Sbjct: 80 SVASTTGFSKECYCCR 95 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,416 Number of Sequences: 438 Number of extensions: 4072 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -