BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0847 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 5.4 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 7.1 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 7.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = +2 Query: 467 IPYAAFLKKVMA*KTSQLVISLVIRSFPATNVRW 568 +PY + KV A L + + +P ++W Sbjct: 519 LPYIRLIPKVTAVAGETLRLKCPVAGYPIEEIKW 552 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = +2 Query: 467 IPYAAFLKKVMA*KTSQLVISLVIRSFPATNVRW 568 +PY + KV A L + + +P ++W Sbjct: 519 LPYIRLIPKVTAVAGETLRLKCPVAGYPIEEIKW 552 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 484 PEEGHGVEDITTRHIFSYKILS 549 P EG + D RHI IL+ Sbjct: 364 PSEGEDISDYKFRHITEITILT 385 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 338 SCHTASDIPGNLHTLPGLCLSLLG 267 S T ++ LHT+ +C+ +G Sbjct: 15 SAMTLDELKSGLHTVQSVCMKEIG 38 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 213 QRRRARSCSHSKSSFPSTAKQRKTKTRER 299 +R+R S ++S S A KTK R + Sbjct: 215 KRKRKSSTIENESETESNASSTKTKMRRK 243 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,260 Number of Sequences: 438 Number of extensions: 3174 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -