BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0838 (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 25 2.1 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 23 4.9 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 6.4 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 6.4 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 8.5 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 24.6 bits (51), Expect = 2.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 167 HYYFLCIIIRESDTHINISLSIKHMYFLPGIPS 265 H YFL I I T + +S+S+ H Y + I S Sbjct: 203 HAYFLTITILLLATFVFVSVSMGHAYRISFIES 235 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 23.4 bits (48), Expect = 4.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 474 RYIGSIPGTVFCIKRA*VLLIVVINTRPNYNRHSY 370 + IG++ +FC A VLL++ N P ++ Y Sbjct: 93 KQIGNMSPLMFCSSLAMVLLLLQANVVPANGKYVY 127 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 23.0 bits (47), Expect = 6.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 436 QACIGSFNSSNKHKTQLQPTQLFSIIQVYV 347 Q + S+N + K PTQL SI +Y+ Sbjct: 328 QTLVNSYNPTLAPKACCVPTQLSSISMLYL 357 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 6.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 69 PEGPGQVLRHGEAE 28 P PGQVL GE E Sbjct: 401 PASPGQVLERGEEE 414 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 22.6 bits (46), Expect = 8.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 59 LARCSATARQSASCAGAPR 3 L++ AT QSAS +G PR Sbjct: 374 LSQLDATGGQSASTSGLPR 392 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,100 Number of Sequences: 2352 Number of extensions: 11065 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -