BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0838 (535 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 25 0.64 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 4.5 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 4.5 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.5 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 6.0 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 7.9 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 7.9 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 7.9 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 7.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.9 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.9 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 24.6 bits (51), Expect = 0.64 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = -1 Query: 484 ILKSIYWIDSRDSFLHQACIGSFNSSNKHKTQLQPTQL 371 I K ++ +S ++ G+FN +++KT +PT + Sbjct: 297 IQKGLFLFACTNSCMNPIVYGAFNIRDRNKTSARPTTI 334 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 96 NNYNNYNKHNYNKLY 110 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 329 NNYNNYNKHNYNKLY 343 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 402 NTRPNYNRHSYSQ*Y 358 N NYN+H+Y++ Y Sbjct: 329 NNYNNYNKHNYNKLY 343 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 6.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 418 KNLCTLDAENC 450 K LC DA+NC Sbjct: 668 KTLCKCDAQNC 678 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 23 HNEKEKLLEERTSC 36 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 23 HNEKEKLLEERTSC 36 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 23 HNEKEKLLEERTSC 36 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 23 HNEKEKLLEERTSC 36 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 256 HNEKEKLLEERTSC 269 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 256 HNEKEKLLEERTSC 269 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 256 HNEKEKLLEERTSC 269 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 256 HNEKEKLLEERTSC 269 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 256 HNEKEKLLEERTSC 269 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 42 HGEAERLLRGRPSC 1 H E E+LL R SC Sbjct: 245 HNEKEKLLEERTSC 258 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,918 Number of Sequences: 438 Number of extensions: 2786 Number of successful extensions: 23 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -